CATH Domain: 2uvoA03 XML data for domain: 2uvoA03

Molscript image for 2uvoA03
2uvoA03
PDB coordinates for domain 2uvoA03

PDB 2uvo, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.60 Wheat Germ Agglutinin (Isolectin 2); domain 1
3.30.60.10 Gene3D
3.30.60.10.2
3.30.60.10.2.3
3.30.60.10.2.3.1
3.30.60.10.2.3.1.1
3.30.60.10.2.3.1.1.1

Segment boundaries for domain 2uvoA03

Chopping figure for domain 2uvoA03
DomainStart PDB ResidueStop PDB Residue
2uvoA01 2 42
2uvoA02 43 85
2uvoA03 86 128
2uvoA04 129 170

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.60.10.2.3.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1wgtA04 97.70 Agglutinin isolectin 3Triticum aestivum 3.30.60.10 43 100 97 0.30 0.31
1p0t100 71.67 Tumor necrosis factor receptor superfamily member 13CTumor necrosis factor receptor superfamily, member 13CCytokine-cytokine receptor interactionIntestinal immune network for IgA productionPrimary immunodeficiency 2.10.50.10 24 12 54 2.65 4.84
Displaying entries 1 to 2 (page 1 of 1)


Domain ATOM Sequence

>pdb|2uvoA03
DIKCGSQAGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACST    

Domain COMBS Sequence

>pdb|2uvoA03
DIKCGSQAGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACST    

Domain History Events (22)

Domain assigned by auto on 27 Jul 2008 21:56

Assigning to "3.30.60.10" based on similarity with "2uwgB03"

Flow stage update by auto on 27 Jul 2008 21:56

No in_process hits for Domain "2uvoA03" ready to be processed

Update comment by auto on 27 Jul 2008 21:52

Domain "2uvoA03" hits Domain "2uvoE02" (60.4651162790698% over 100%) which is currently in process

Update comment by auto on 27 Jul 2008 21:50

Domain "2uvoA03" hits Domain "2uvoF04" (58.1395348837209% over 100%) which is currently in process

Update comment by auto on 27 Jul 2008 21:48

Domain "2uvoA03" hits Domain "2uvoA04" (58.1395348837209% over 100%) which is currently in process

Update comment by auto on 27 Jul 2008 21:46

Domain "2uvoA03" hits Domain "2uvoB02" (60.4651162790698% over 100%) which is currently in process

Update comment by auto on 27 Jul 2008 21:43

Domain "2uvoA03" hits Domain "2uvoF03" (100% over 100%) which is currently in process

Update comment by auto on 27 Jul 2008 21:41

Domain "2uvoA03" hits Domain "2uvoF02" (60.4651162790698% over 100%) which is currently in process

Update comment by auto on 27 Jul 2008 21:36

Domain "2uvoA03" hits Domain "2uvoE04" (58.1395348837209% over 100%) which is currently in process

Update comment by auto on 27 Jul 2008 21:33

Domain "2uvoA03" hits Domain "2uvoB01" (59.5238095238095% over 97.6744186046512%) which is currently in process

Update comment by auto on 27 Jul 2008 21:30

Domain "2uvoA03" hits Domain "2uvoA02" (60.4651162790698% over 100%) which is currently in process

Update comment by auto on 27 Jul 2008 21:28

Domain "2uvoA03" hits Domain "2uvoE03" (100% over 100%) which is currently in process

Update comment by auto on 27 Jul 2008 21:22

Domain "2uvoA03" hits Domain "2uvoB04" (58.1395348837209% over 100%) which is currently in process

Update comment by auto on 27 Jul 2008 21:10

Domain "2uvoA03" hits Domain "2uvoF01" (59.5238095238095% over 97.6744186046512%) which is currently in process

Update comment by auto on 27 Jul 2008 20:52

Domain "2uvoA03" hits Domain "2uvoE01" (59.5238095238095% over 97.6744186046512%) which is currently in process

Update comment by auto on 27 Jul 2008 20:37

Domain "2uvoA03" hits Domain "2uvoB03" (100% over 100%) which is currently in process

Update comment by auto on 27 Jul 2008 17:42

Domain "2uvoA03" hits Domain "2uvoA01" (59.5238095238095% over 97.6744186046512%) which is currently in process

Flow stage update by auto on 27 Jul 2008 17:23

Domain "2uvoA03" hits Domain "2uvoA01" (59.5238095238095% over 97.6744186046512%) which is currently in process

Flow stage update by auto on 27 Jul 2008 17:23

NW result present for Domain "2uvoA03"

Flow stage update by auto on 26 Jul 2008 11:49

All required files are present for Domain "2uvoA03"

Flow stage update by auto on 25 Jul 2008 19:45

Beginning processing for Domain "2uvoA03"

Insertion by auto on 25 Jul 2008 17:16

Final ChopClose added based on similarity with "1wgcA"