CATH Domain: 2ptrB03 XML data for domain: 2ptrB03

Molscript image for 2ptrB03
2ptrB03
PDB coordinates for domain 2ptrB03

PDB 2ptr, Chain B, Domain 3

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.40 Ribonucleotide Reductase Protein R1; domain 1
1.10.40.30 Fumarase/aspartase (C-terminal domain) Gene3D
1.10.40.30.1
1.10.40.30.1.1
1.10.40.30.1.1.1
1.10.40.30.1.1.1.1
1.10.40.30.1.1.1.1.1

[top]
Segment boundaries for domain 2ptrB03

Chopping figure for domain 2ptrB03
DomainStart PDB ResidueStop PDB Residue
2ptrB01 1 117
2ptrB02 118 381
2ptrB02 446 459
2ptrB03 382 445

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 1.10.40.30.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2fdrA02 80.17 Agrobacterium tumefaciens str. C58Putative uncharacterized protein 1.10.150.240 64 7 89 3.50 3.93
1tj7A03 79.23 Arginine and proline metabolismAlanine, aspartate and glutamate metabolismMetabolic pathwaysArgininosuccinate lyase [EC:4.3.2.1]Argininosuccinate lyase 1.10.40.30 71 6 87 4.03 4.62
2fi1A02 78.85 Hydrolase, haloacid dehalogenase-like familyStreptococcus pneumoniae 1.10.150.240 64 10 90 3.84 4.24
1c3cA03 77.81 Thermotoga maritimaAdenylosuccinate lyaseAdenylosuccinate lyase [EC:4.3.2.2]Purine metabolismAlanine, aspartate and glutamate metabolism 1.10.40.30 81 10 75 3.40 4.51
2ah5A02 77.30 Glyoxylate and dicarboxylate metabolismMetabolic pathwaysPhosphoglycolate phosphatase [EC:3.1.3.18]Hydrolase, haloacid dehalogenase-like familyStreptococcus pneumoniae 1.10.150.240 64 6 89 4.17 4.68
2nyvA02 76.74 Phosphoglycolate phosphatase [EC:3.1.3.18]Metabolic pathwaysGlyoxylate and dicarboxylate metabolismAquifex aeolicusPhosphoglycolate phosphatase 1.10.150.240 64 9 95 4.50 4.72
2hdoA02 75.35 Phosphoglycolate phosphatase [EC:3.1.3.18]Lactobacillus plantarumMetabolic pathwaysGlyoxylate and dicarboxylate metabolismPhosphoglycolate phosphatase (Putative) 1.10.150.240 59 8 81 4.03 4.96
2wf7A02 74.10 Starch and sucrose metabolismLactococcus lactis subsp. lactisBeta-phosphoglucomutaseBeta-phosphoglucomutase [EC:5.4.2.6] 1.10.150.240 78 9 74 3.69 4.96
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2ptrB03
WEVLAEPIQTVMRRYGIEKPYEKLKELTRGKRVDAEGMKQFIDGLALPEEEKARLKAMTPANYI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2ptrB03
WEVLAEPIQTVMRRYGIEKPYEKLKELTRGKRVDAEGMKQFIDGLALPEEEKARLKAMTPANYI
BLAST against CATH

[top]
Domain History Events (15)

Domain assigned by auto on 01 May 2009 14:46

Assigning to "1.10.40.30" based on similarity with "2ptqA03"

Flow stage update by auto on 01 May 2009 14:46

No in_process hits for Domain "2ptrB03" ready to be processed

Update comment by auto on 01 May 2009 14:44

Domain "2ptrB03" hits Domain "2ptqB03" (100% over 100%) which is currently in process

Update comment by auto on 01 May 2009 14:42

Domain "2ptrB03" hits Domain "2ptqA03" (100% over 100%) which is currently in process

Update comment by auto on 01 May 2009 14:40

Domain "2ptrB03" hits Domain "2ptrA03" (100% over 100%) which is currently in process

Update comment by auto on 01 May 2009 14:38

Domain "2ptrB03" hits Domain "2hvgA03" (42.1875% over 96.969696969697%) which is currently in process

Update comment by auto on 01 May 2009 14:36

Domain "2ptrB03" hits Domain "2hvgB03" (42.1875% over 96.969696969697%) which is currently in process

Update comment by auto on 01 May 2009 14:34

Domain "2ptrB03" hits Domain "3bhgA03" (59.375% over 100%) which is currently in process

Update comment by auto on 01 May 2009 14:26

Domain "2ptrB03" hits Domain "2qgaC03" (45.3125% over 96.969696969697%) which is currently in process

Update comment by auto on 10 Dec 2008 14:34

Domain "2ptrB03" hits Domain "2qgaB03" (45.3125% over 96.969696969697%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:19

Domain "2ptrB03" hits Domain "2qgaB03" (45.3125% over 96.969696969697%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:17

NW result present for Domain "2ptrB03"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "2ptrB03"

Flow stage update by auto on 10 Dec 2008 14:15

Beginning processing for Domain "2ptrB03"

Insertion by auto on 05 Dec 2008 18:04

Final ChopClose added based on similarity with "2ptqA"