CATH Domain: 2ptrA02 XML data for domain: 2ptrA02

Molscript image for 2ptrA02
2ptrA02
PDB coordinates for domain 2ptrA02

PDB 2ptr, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.200 Fumarase C; Chain A, domain 2
1.20.200.10 Fumarase/aspartase (Central domain) Gene3D
1.20.200.10.2
1.20.200.10.2.1
1.20.200.10.2.1.1
1.20.200.10.2.1.1.1
1.20.200.10.2.1.1.1.1

[top]
Segment boundaries for domain 2ptrA02

Chopping figure for domain 2ptrA02
DomainStart PDB ResidueStop PDB Residue
2ptrA01 1 117
2ptrA02 118 381
2ptrA02 446 459
2ptrA03 382 445

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 1.20.200.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1c3cA02 86.84 Thermotoga maritimaAdenylosuccinate lyaseAdenylosuccinate lyase [EC:4.3.2.2]Purine metabolismAlanine, aspartate and glutamate metabolism 1.20.200.10 251 23 88 1.98 2.25
3c8tA02 84.79 Chelativorans sp. BNC1Fumarate lyaseBenzoate degradation via hydroxylation3-carboxy-cis,cis-muconate cycloisomerase [EC:5.5.1.2]Metabolic pathways 1.20.200.10 241 18 84 1.87 2.21
1yisA02 84.73 LocomotionPurine metabolismBody morphogenesisEmbryo development ending in birth or egg hatchingMetabolic pathways 1.20.200.10 310 15 83 1.77 2.11
1tj7A02 84.36 Arginine and proline metabolismAlanine, aspartate and glutamate metabolismMetabolic pathwaysArgininosuccinate lyase [EC:4.3.2.1]Argininosuccinate lyase 1.20.200.10 279 16 93 2.87 3.06
1vdkA02 83.38 Fumarate hydratase class II (Fumarase C)Thermus thermophilus 1.20.200.10 266 16 88 2.64 3.00
1k7wA02 82.58 Argininosuccinate lyaseArgininosuccinate lyase activityAnas platyrhynchosStructural constituent of eye lens 1.20.200.10 228 17 76 3.66 4.75
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2ptrA02
HFACTSEDINNLSHALMLKTARDEVILPYWRQLIDGLKDLAVQYRDIPLLSRTAGQPATPSTIGKEMANVAYRMERQYRQ
LNQVEILGKINGAVGNYNAHIAAYPEVDWHQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDVWG
YIALNHFKQKTIAGEIGSSTMPHKVNPIDFENSEGNLGLSNAVLQHLASKLPVSRWQRDLTDSTVLRNLGVGIGYALIAY
QSTLKGVSKLEVNRDHLLDELDHNGRAITMVDELKHHH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2ptrA02
HFACTSEDINNLSHALMLKTARDEVILPYWRQLIDGLKDLAVQYRDIPLLSRTAGQPATPSTIGKEMANVAYRMERQYRQ
LNQVEILGKINGAVGNYNAHIAAYPEVDWHQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDVWG
YIALNHFKQKTIAGEIGSSTMPHKVNPIDFENSEGNLGLSNAVLQHLASKLPVSRWQRDLTDSTVLRNLGVGIGYALIAY
QSTLKGVSKLEVNRDHLLDELDHNGRAITMVDELKHHHHHH
BLAST against CATH

[top]
Domain History Events (13)

Domain assigned by auto on 16 Mar 2009 17:57

Assigning to "1.20.200.10" based on similarity with "2ptsA02"

Flow stage update by auto on 16 Mar 2009 17:57

No in_process hits for Domain "2ptrA02" ready to be processed

Update comment by auto on 16 Mar 2009 17:54

Domain "2ptrA02" hits Domain "2ptsA02" (97.864768683274% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 17:52

Domain "2ptrA02" hits Domain "2hvgB02" (47.6868327402135% over 99.2932862190813%) which is currently in process

Update comment by auto on 16 Mar 2009 17:49

Domain "2ptrA02" hits Domain "2hvgA02" (47.6868327402135% over 99.2932862190813%) which is currently in process

Update comment by auto on 16 Mar 2009 17:47

Domain "2ptrA02" hits Domain "3bhgA02" (58.1818181818182% over 97.864768683274%) which is currently in process

Update comment by auto on 16 Mar 2009 17:44

Domain "2ptrA02" hits Domain "2qgaC02" (48.3985765124555% over 99.2932862190813%) which is currently in process

Update comment by auto on 10 Dec 2008 14:34

Domain "2ptrA02" hits Domain "2qgaB02" (48.3985765124555% over 99.2932862190813%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:19

Domain "2ptrA02" hits Domain "2qgaB02" (48.3985765124555% over 99.2932862190813%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:17

NW result present for Domain "2ptrA02"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "2ptrA02"

Flow stage update by auto on 10 Dec 2008 14:15

Beginning processing for Domain "2ptrA02"

Insertion by auto on 05 Dec 2008 18:13

Final ChopClose added based on similarity with "2ptrB"