CATH Domain: 2prrA01 XML data for domain: 2prrA01

Molscript image for 2prrA01
2prrA01
PDB coordinates for domain 2prrA01

PDB 2prr, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.5 Single alpha-helices involved in coiled-coils or other helix-helix interfaces
1.20.5.810 AhpD-like Gene3D
1.20.5.810.3
1.20.5.810.3.1
1.20.5.810.3.1.1
1.20.5.810.3.1.1.1
1.20.5.810.3.1.1.1.1

[top]
Segment boundaries for domain 2prrA01

Chopping figure for domain 2prrA01
DomainStart PDB ResidueStop PDB Residue
2prrA01 15 67
2prrA02 68 194

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2prrA01
ELAALPDDIRQRILEVQDKAGFVPNVFLTLAHRPDEFRAFFAYHDALLKDGG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2prrA01
ELAALPDDIRQRILEVQDKAGFVPNVFLTLAHRPDEFRAFFAYHDALXLKDGG
BLAST against CATH

[top]
Domain History Events (13)

Domain assigned by auto on 09 Apr 2008 14:27

Assigning to "1.20.5.810" based on similarity with "2prrC01"

Flow stage update by auto on 09 Apr 2008 14:25

No in_process hits for Domain "2prrA01" ready to be processed

Update comment by auto on 09 Apr 2008 14:24

Domain "2prrA01" hits Domain "2prrF01" (98.1132075471698% over 100%) which is currently in process

Update comment by auto on 09 Apr 2008 14:22

Domain "2prrA01" hits Domain "2prrH01" (98.1132075471698% over 100%) which is currently in process

Update comment by auto on 09 Apr 2008 14:16

Domain "2prrA01" hits Domain "2prrC01" (98.1132075471698% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "2prrA01" hits Domain "2prrK01" (98.1132075471698% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2prrA01" hits Domain "2prrK01" (98.1132075471698% over 100%) which is currently in process

Update comment by auto on 01 Sep 2007 18:04

Domain "2prrA01" hits Domain "2prrK01" (98.1132075471698% over 100%) which is currently in process

Flow stage update by auto on 01 Sep 2007 18:04

Domain "2prrA01" hits Domain "2prrK01" (98.1132075471698% over 100%) which is currently in process

Flow stage update by auto on 01 Sep 2007 18:04

NW result present for Domain "2prrA01"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2prrA01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2prrA01"

Insertion by auto on 23 Aug 2007 15:53

Final ChopClose added based on similarity with "2prrC"