CATH Domain: 2pjuC01 XML data for domain: 2pjuC01

Molscript image for 2pjuC01
2pjuC01
PDB coordinates for domain 2pjuC01

PDB 2pju, Chain C, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.2300 Gene3D
3.40.50.2300.100
3.40.50.2300.100.1
3.40.50.2300.100.1.1
3.40.50.2300.100.1.1.1
3.40.50.2300.100.1.1.1.1

Segment boundaries for domain 2pjuC01

Chopping figure for domain 2pjuC01
DomainStart PDB ResidueStop PDB Residue
2pjuC01 11 88
2pjuC01 177 198
2pjuC02 89 176

Structural Neighbourhood (13 entries)

There are 13 matching structural neighberhood comparisons for CATH ID 3.40.50.2300.100.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 13 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vrvA00 81.66 Phosphotransferase system (PTS)Fructose and mannose metabolismPTS system, mannitol-specific IIC componentPTS system, mannitol-specific IIA component [EC:2.7.1.69]PTS system, mannitol-specific IIB component [EC:2.7.1.69] 3.40.50.10370 96 6 84 2.93 3.49
2kyrA00 80.57 PTS system, fructose-specific IIB-like component [EC:2.7.1.69]Escherichia coli K-12Fructose-like phosphotransferase enzyme IIB component 1 3.40.50.2300 108 8 88 4.39 4.94
3eq2B01 79.81 Pseudomonas aeruginosaProbable two-component response regulator 3.40.50.2300 103 9 73 2.39 3.24
2qzjA00 79.27 Two-component response regulatorClostridium difficile 630 3.40.50.2300 119 8 76 2.51 3.28
2q5cA02 78.06 Clostridium acetobutylicumNtrC family transcriptional regulator (PAS and AAA domains) 3.40.50.10660 89 7 71 2.67 3.76
2pjuA02 77.28 Positive regulation of gene-specific transcriptionPropionate catabolism operon regulatory proteinNegative regulation of gene-specific transcriptionEscherichia coli K-12Specific transcriptional repressor activity 3.40.50.10660 88 12 72 2.93 4.07
1p6qA00 77.14 CheY2Two-component system, chemotaxis family, response regulator CheYBacterial chemotaxisSinorhizobium melilotiTwo-component system 3.40.50.2300 129 11 68 3.37 4.88
3cwcB01 76.85 Glycerate kinase [EC:2.7.1.31]Glycerolipid metabolismSalmonella enterica subsp. enterica serovar TyphimuriumPutative glycerate kinase 2Glycine, serine and threonine metabolism 3.40.50.10350 137 14 65 3.12 4.75
1cvrA01 76.72 Gingipain R [EC:3.4.22.37]Porphyromonas gingivalisGingipain R2 3.40.50.10390 117 6 68 2.72 3.98
1z0sA01 75.73 Archaeoglobus fulgidusProbable inorganic polyphosphate/ATP-NAD kinaseNAD+ kinase [EC:2.7.1.23]Nicotinate and nicotinamide metabolismMetabolic pathways 3.40.50.10330 123 9 66 3.01 4.51
3kuuD00 75.56 Purine metabolismMetabolic pathwaysPhosphoribosylaminoimidazole carboxylase catalytic subunit PurE5-(carboxyamino)imidazole ribonucleotide mutase [EC:5.4.99.18]Yersinia pestis 3.40.50.7700 150 13 63 2.97 4.69
1pzxB01 74.51 Geobacillus stearothermophilusLipid binding protein 3.40.50.10440 122 15 75 3.65 4.84
1g7sA03 74.11 Methanothermobacter thermautotrophicus str. Delta HTranslation initiation factor IF-2 unclassified subunitProbable translation initiation factor IF-2 3.40.50.10050 81 8 71 3.45 4.86
Displaying entries 1 to 13 (page 1 of 1)


Domain ATOM Sequence

>pdb|2pjuC01
KPVIWTVSVTRLFELFRDISLEFDHLANITPIQLGFEKAVTYIRKKLANERCDAIIAAGSNGAYLKSRLSVPVILIKPYS
AATVRQAFSDALDMTRMSLR    

Domain COMBS Sequence

>pdb|2pjuC01
MSLAHPPRLNDDKPVIWTVSVTRLFELFRDISLEFDHLANITPIQLGFEKAVTYIRKKLANERCDAIIAAGSNGAYLKSR
LSVPVILIKPYSAATVRQAFSDALDMTRMSLR    

Domain History Events (13)

Domain assigned by auto on 18 Mar 2009 14:28

Assigning to "3.40.50.2300" based on similarity with "2pjuB01"

Flow stage update by auto on 18 Mar 2009 14:23

No in_process hits for Domain "2pjuC01" ready to be processed

Update comment by auto on 18 Mar 2009 14:07

Domain "2pjuC01" hits Domain "2pjuB01" (100% over 99.1071428571429%) which is currently in process

Update comment by auto on 03 Mar 2009 20:59

Domain "2pjuC01" hits Domain "2pjuA01" (100% over 98.2142857142857%) which is currently in process

Update comment by auto on 23 Jul 2008 18:00

Domain "2pjuC01" hits Domain "2pjuD01" (100% over 80.3571428571429%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "2pjuC01" hits Domain "2pjuD01" (100% over 80.3571428571429%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2pjuC01" hits Domain "2pjuD01" (100% over 80.3571428571429%) which is currently in process

Update comment by auto on 28 Aug 2007 14:06

Domain "2pjuC01" hits Domain "2pjuD01" (100% over 80.3571428571429%) which is currently in process

Flow stage update by auto on 28 Aug 2007 14:05

Domain "2pjuC01" hits Domain "2pjuD01" (100% over 80.3571428571429%) which is currently in process

Flow stage update by auto on 28 Aug 2007 14:05

NW result present for Domain "2pjuC01"

Flow stage update by auto on 22 Aug 2007 10:07

All required files are present for Domain "2pjuC01"

Flow stage update by auto on 21 Aug 2007 17:49

Beginning processing for Domain "2pjuC01"

Insertion by cuff on 21 Aug 2007 11:09

nice chopping