CATH Domain: 1zy8K00 XML data for domain: 1zy8K00

Molscript image for 1zy8K00
1zy8K00
PDB coordinates for domain 1zy8K00

PDB 1zy8, Chain K, Domain 0

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.320 Dihydrolipoamide Transferase
4.10.320.10 Dihydrolipoamide Transferase Gene3D
4.10.320.10.2
4.10.320.10.2.1
4.10.320.10.2.1.1
4.10.320.10.2.1.1.1
4.10.320.10.2.1.1.1.1

[top]
Segment boundaries for domain 1zy8K00

Chopping figure for domain 1zy8K00
DomainStart PDB ResidueStop PDB Residue
1zy8K00 130 173

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 4.10.320.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1w3dA00 87.34 Geobacillus stearothermophilusDihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex 4.10.320.10 45 20 91 2.25 2.47
1zwvA00 82.07 Mitochondrial alpha-ketoglutarate dehydrogenase complexLipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrialHomo sapiensMitochondrial nucleoid 4.10.320.10 52 22 84 3.12 3.69
1njgA02 76.64 Pyrimidine metabolismDNA replicationPurine metabolismMetabolic pathwaysHomologous recombination 1.10.8.60 66 15 59 2.87 4.86
2chgA02 76.62 Archaeoglobus fulgidusReplication factor C small subunitReplication factor C small subunit 1.10.8.60 66 4 56 1.87 3.34
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1zy8K00
RLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1zy8K00
RLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTG
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 30 Nov 2006 17:24

Assigning to "4.10.320.10" based on similarity with "1zy8N00"

Flow stage update by auto on 30 Nov 2006 17:23

No in_process hits for Domain "1zy8K00" ready to be processed

Update comment by auto on 30 Nov 2006 13:29

Domain "1zy8K00" hits Domain "1zy8O00" (100% over 100%) which is currently in process

Update comment by auto on 30 Nov 2006 09:22

Domain "1zy8K00" hits Domain "1zy8M00" (100% over 100%) which is currently in process

Flow stage update by auto on 30 Nov 2006 09:21

Domain "1zy8K00" hits Domain "1zy8M00" (100% over 100%) which is currently in process

Flow stage update by auto on 30 Nov 2006 09:21

NW result present for Domain "1zy8K00"

Flow stage update by auto on 29 Nov 2006 13:24

All required files are present for Domain "1zy8K00"

Flow stage update by auto on 28 Nov 2006 21:32

Beginning processing for Domain "1zy8K00"

Insertion by auto on 28 Nov 2006 21:23

Final ChopClose added based on similarity with "1zy8N"