Domain assigned by auto on 28 Apr 2006 18:42
Assigning to "2.60.40.420" based on similarity with "1oczO02" (NWSI: 100, NWO: 100, SPS: 97.39, SPO: 100, RMSD: 0.29)
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1v54B01 | 2 | 91 |
| 1v54B02 | 92 | 227 |
There are 7 matching structural neighberhood comparisons for CATH ID 2.60.40.420.16.1.1.1.1 (SIMAX score < 5)
>pdb|1v54B02 NPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLK TDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Assigning to "2.60.40.420" based on similarity with "1oczO02" (NWSI: 100, NWO: 100, SPS: 97.39, SPO: 100, RMSD: 0.29)
NW result present for Domain "1v54B02"
All required files are present for Domain "1v54B02"
Beginning processing for Domain "1v54B02"