Domain assigned by auto on 28 Apr 2006 18:47
Assigning to "3.30.9.10" based on similarity with "1ng3B02" (NWSI: 99.2857142857143, NWO: 100, SPS: 97.28, SPO: 100, RMSD: 0.44)
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1ryiA01 | 1 | 91 |
| 1ryiA01 | 145 | 218 |
| 1ryiA01 | 306 | 364 |
| 1ryiA02 | 92 | 144 |
| 1ryiA02 | 219 | 305 |
There are 3 matching structural neighberhood comparisons for CATH ID 3.30.9.10.6.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
3g3eA02 | 84.94 | 3.30.9.10 | 141 | 15 | 87 | 3.60 | 4.09 | |
![]() |
2uzzA02 | 76.05 | 3.30.9.10 | 191 | 12 | 72 | 2.70 | 3.74 | |
![]() |
3c4nA02 | 73.38 | 3.30.9.10 | 124 | 10 | 74 | 3.60 | 4.85 |
>pdb|1ryiA02 NGGMFKLAFSEEDVLQLRQMDDLDSVSWYSKEEVLEKEPYASGDIFGASFIQDFLPVKGECLSVWNDDIPLTKTLYHDHC YIVPRKSGRLVVGATMKPGDWSETPDLGGLESVMKKAKTMLPAIQNMKVDRFWAGLRPGT
Assigning to "3.30.9.10" based on similarity with "1ng3B02" (NWSI: 99.2857142857143, NWO: 100, SPS: 97.28, SPO: 100, RMSD: 0.44)
NW result present for Domain "1ryiA02"
All required files are present for Domain "1ryiA02"
Beginning processing for Domain "1ryiA02"