Set cath from cathlist by auto on 05 Mar 2006 18:07
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1octC01 | 5 | 75 |
| 1octC02 | 102 | 161 |
There are 15 matching structural neighberhood comparisons for CATH ID 1.10.260.40.8.1.1.2.1 (SIMAX score < 5)
>pdb|1octC01 DLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAE
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"