Set cath from cathlist by auto on 05 Mar 2006 18:20
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
There are 4 matching structural neighberhood comparisons for CATH ID 1.20.1070.10.1.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1c8rA00 | 98.18 | 1.20.1070.10 | 222 | 99 | 100 | 0.34 | 0.34 | |
![]() |
1h2sA00 | 92.70 | 1.20.1070.10 | 225 | 27 | 95 | 1.47 | 1.54 | |
![]() |
1xioA00 | 91.15 | 1.20.1070.10 | 217 | 27 | 93 | 1.97 | 2.11 | |
![]() |
2jafA00 | 90.28 | 1.20.1070.10 | 242 | 32 | 91 | 1.71 | 1.86 |
>pdb|1m0kA00 TGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVPFGGEQNPIYWARYA DWLFTTPLLLLDLALLVDADQGTILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGFSMRPEVAS TFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSRAIFG
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"