Set cath from cathlist by auto on 05 Mar 2006 18:43
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1hx0A01 | 2 | 403 |
| 1hx0A02 | 404 | 496 |
There are 21 matching structural neighberhood comparisons for CATH ID 2.60.40.1180.1.1.1.1.1 (SIMAX score < 5)
>pdb|1hx0A02 QPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSA EDPFIAIHAESKL
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"