Set cath from cathlist by auto on 05 Mar 2006 19:32
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1ek6A01 | 190 | 239 |
| 1ek6A01 | 271 | 346 |
| 1ek6A02 | 3 | 189 |
| 1ek6A02 | 240 | 270 |
There are 5 matching structural neighberhood comparisons for CATH ID 3.90.25.10.6.1.1.1.1 (SIMAX score < 5)
>pdb|1ek6A01 GAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRTGTGYSVLQMVQAMEKASGKKIPYKVVARR EGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGT
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"