CATH Domain: 1ehsA00 XML data for domain: 1ehsA00

Molscript image for 1ehsA00
1ehsA00
PDB coordinates for domain 1ehsA00

PDB 1ehs, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.10 Heat-Stable Enterotoxin B
1.20.10.10 Heat-Stable Enterotoxin B Gene3D
1.20.10.10.1
1.20.10.10.1.1
1.20.10.10.1.1.1
1.20.10.10.1.1.1.1
1.20.10.10.1.1.1.1.1

[top]
Segment boundaries for domain 1ehsA00

Chopping figure for domain 1ehsA00
DomainStart PDB ResidueStop PDB Residue
1ehsA00 1 48

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1ehsA00
STQSNKKDLCEHYRQIAKESCKKGFLGVRDGTAGACFGAQIMVAAKGC
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ehsA00
STQSNKKDLCEHYRQIAKESCKKGFLGVRDGTAGACFGAQIMVAAKGC
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1ehs000" to "1ehsA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:17

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:17

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:39

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"