CATH Domain: 1ehiA03 XML data for domain: 1ehiA03

Molscript image for 1ehiA03
1ehiA03
PDB coordinates for domain 1ehiA03

PDB 1ehi, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1490 Dna Ligase; domain 1
3.30.1490.20 ATP-grasp fold, A domain Gene3D
3.30.1490.20.14
3.30.1490.20.14.1
3.30.1490.20.14.1.1
3.30.1490.20.14.1.1.1
3.30.1490.20.14.1.1.1.1

[top]
Segment boundaries for domain 1ehiA03

Chopping figure for domain 1ehiA03
DomainStart PDB ResidueStop PDB Residue
1ehiA01 3 122
1ehiA02 219 362
1ehiA03 151 218

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.30.1490.20.14.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2nu8B02 81.22 Citrate cycle (TCA cycle)Propanoate metabolismMetabolic pathwaysC5-Branched dibasic acid metabolismTricarboxylic acid cycle 3.30.1490.20 84 13 76 2.47 3.24
2r6fA03 80.83 Nucleotide excision repairGeobacillus kaustophilusExcinuclease ABC subunit AExcinuclease ABC subunit A 3.30.1490.20 70 10 78 2.55 3.25
1wmhA00 78.25 Tight junctionInsulin signaling pathwayEndocytosisVesicle-mediated transportProtein binding 3.10.20.240 83 11 72 3.58 4.95
2c60A01 78.01 Neurotrophin signaling pathwayMitogen-activated protein kinase kinase kinase 3MAPKKK cascadeProtein bindingPositive regulation of I-kappaB kinase/NF-kappaB cascade 3.10.20.240 77 7 75 3.44 4.57
1x9nA02 77.17 Nucleotide excision repairDNA replicationDNA ligase 1Base excision repairDNA binding 3.30.1490.70 83 8 66 3.09 4.66
1wmhB00 75.37 Partitioning defective 6 homolog alphaTranscription factor bindingViral reproductionHomo sapiens 3.10.20.240 82 7 70 3.42 4.84
2kfjA00 75.18 Cell division control protein 24MAPK signaling pathway - yeastMating projection tipInvasive growth in response to glucose limitationCell division control protein 24 3.10.20.240 86 10 67 3.07 4.55
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ehiA03
TKYIVVDPESANNWSWDKIVAELGNIVFVKAANQGSSVGISRVTNAEEYTEALSDSFQYDYKVLIEEA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ehiA03
TKYIVVDPESANNWSWDKIVAELGNIVFVKAANQGSSVGISRVTNAEEYTEALSDSFQYDYKVLIEEA
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:10

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:10

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:27

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"