Set cath from cathlist by auto on 05 Mar 2006 19:04
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1ec7C01 | 6 | 137 |
| 1ec7C01 | 399 | 416 |
| 1ec7C02 | 138 | 398 |
There are 15 matching structural neighberhood comparisons for CATH ID 3.30.390.10.16.1.1.1.1 (SIMAX score < 5)
>pdb|1ec7C01 TTPVVTEMQVIPVAGHDSMLMNLSGAHAPFFTRNIVIIKDNSGHTGVGEIPGGEKIRKTLEDAIPLVVGKTLGEYKNVLT LVRNTFARTTIHVVTGIEAAMLDLLGQHLGVNVASLLGGVEIDMDQVMKAHELYQK
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"