CATH Domain: 1ec7C01 XML data for domain: 1ec7C01

Molscript image for 1ec7C01
1ec7C01
PDB coordinates for domain 1ec7C01

PDB 1ec7, Chain C, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.10 Enolase-like, N-terminal domain Gene3D
3.30.390.10.16
3.30.390.10.16.1
3.30.390.10.16.1.1
3.30.390.10.16.1.1.1
3.30.390.10.16.1.1.1.1

[top]
Segment boundaries for domain 1ec7C01

Chopping figure for domain 1ec7C01
DomainStart PDB ResidueStop PDB Residue
1ec7C01 6 137
1ec7C01 399 416
1ec7C02 138 398

Structural Neighbourhood (15 entries)

There are 15 matching structural neighberhood comparisons for CATH ID 3.30.390.10.16.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 15 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2pgwA01 87.25 Sinorhizobium melilotiToluene and xylene degradationBenzoate degradation via hydroxylationMuconate cycloisomerase [EC:5.5.1.1]Mandelate racemase/muconate lactonizing enzyme family protein 3.30.390.10 147 20 89 1.74 1.95
2oqyA01 86.74 Muconate cycloisomeraseOceanobacillus iheyensis 3.30.390.10 142 18 85 1.98 2.32
2ovlA01 86.44 Toluene and xylene degradationStreptomyces coelicolorMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylationPutative racemase 3.30.390.10 123 13 83 1.68 2.02
3bjsA01 86.05 Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme 3.30.390.10 116 17 77 1.63 2.09
3go2A01 86.03 Burkholderia xenovorans LB400Putative uncharacterized protein 3.30.390.10 114 13 78 1.60 2.03
2qjjA01 85.95 Mandelate racemase/muconate lactonizing enzyme, N-terminal domain proteinStarvation sensing protein RspANovosphingobium aromaticivorans DSM 12444 3.30.390.10 140 14 84 2.98 3.54
2qq6B01 85.77 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein 3.30.390.10 115 17 77 2.02 2.59
1tkkA01 85.68 Bacillus subtilisL-Ala-D/L-Glu epimerase 3.30.390.10 115 18 77 1.54 1.99
1nu5A01 85.09 Chloromuconate cycloisomerasePseudomonas sp. P51 3.30.390.10 116 18 77 1.99 2.58
2nqlA01 84.72 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.30.390.10 162 16 80 2.44 3.02
2hzgB01 83.27 Rhodobacter sphaeroides 2.4.1Mandelate racemase/muconate lactonizing enzyme/Enolase superfamily 3.30.390.10 143 16 79 2.94 3.69
1tzzB01 82.21 Bradyrhizobium japonicumBll6730 protein 3.30.390.10 119 10 72 2.89 4.01
1jpdX01 82.08 Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12 3.30.390.10 99 11 67 2.05 3.03
2oz8A01 80.38 Mesorhizobium lotiMll7089 protein 3.30.390.10 128 10 83 3.90 4.65
1stzA03 73.14 Thermotoga maritimaHeat-inducible transcription repressor hrcAHeat-inducible transcriptional repressor 3.30.390.60 89 16 61 3.00 4.92
[1]
Displaying entries 1 to 15 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ec7C01
TTPVVTEMQVIPVAGHDSMLMNLSGAHAPFFTRNIVIIKDNSGHTGVGEIPGGEKIRKTLEDAIPLVVGKTLGEYKNVLT
LVRNTFARTTIHVVTGIEAAMLDLLGQHLGVNVASLLGGVEIDMDQVMKAHELYQK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ec7C01
TTPVVTEMQVIPVAGHDSMLMNLSGAHAPFFTRNIVIIKDNSGHTGVGEIPGGEKIRKTLEDAIPLVVGKTLGEYKNVLT
LVRNTFADRDAGGRGLQTFDLRTTIHVVTGIEAAMLDLLGQHLGVNVASLLGGVEIDMDQVMKAHELYQK
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:26

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"