CATH Domain: 1dugA02 XML data for domain: 1dugA02

Molscript image for 1dugA02
1dugA02
PDB coordinates for domain 1dugA02

PDB 1dug, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1050 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2
1.20.1050.10 Gene3D
1.20.1050.10.18
1.20.1050.10.18.1
1.20.1050.10.18.1.1
1.20.1050.10.18.1.1.1
1.20.1050.10.18.1.1.1.1

[top]
Segment boundaries for domain 1dugA02

Chopping figure for domain 1dugA02
DomainStart PDB ResidueStop PDB Residue
1dugA01 1 80
1dugA01 186 212
1dugA02 81 185

Structural Neighbourhood (12 entries)

There are 12 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.18.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 12 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2dsaA02 89.63 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismBurkholderia xenovorans LB400 1.20.1050.10 106 20 98 1.85 1.89
2gsqA02 88.93 Ommastrephes sloaniGlutathione S-transferase 1.20.1050.10 108 21 94 1.88 1.99
1n2aA02 88.86 Metabolism of xenobiotics by cytochrome P450Glutathione metabolismGlutathione S-transferase [EC:2.5.1.18]Glutathione S-transferaseEscherichia coli K-12 1.20.1050.10 106 15 98 1.85 1.89
1aw9A02 84.20 Glutathione transferase III(A)Zea mays 1.20.1050.10 121 16 85 3.44 4.04
1v2aA02 83.29 Anopheles dirusGlutathione transferase gst1-6 1.20.1050.10 132 17 78 2.53 3.21
1hqoA02 83.20 Soluble fractionCytosolProtein URE2Cytoplasmic sequestering of transcription factorProtein urmylation 1.20.1050.10 126 13 80 2.65 3.27
1gnwA02 83.18 Glutathione bindingMicrosomeChloroplast stromaPlasma membraneToxin catabolic process 1.20.1050.10 125 16 84 3.13 3.73
1nhyA02 82.43 Positive regulation of transcription from RNA polymerase II promoterCalcium ion bindingNucleusElongation factor 1-gamma 1Transcription coactivator activity 1.20.1050.10 139 14 74 2.40 3.21
1gwcA02 80.85 Aegilops tauschiiGlutathione S-transferase 1 1.20.1050.10 141 21 73 2.51 3.40
3cbuA02 80.05 Glutathione S-transferase [EC:2.5.1.18]Ralstonia eutropha JMP134Metabolism of xenobiotics by cytochrome P450Probable gst-related proteinGlutathione metabolism 1.20.1050.10 132 14 74 2.61 3.52
2c3nA02 78.53 Soluble fractionGlutathione S-transferase theta-1Glutathione metabolic processGlutathione transferase activityGlutathione metabolism 1.20.1050.10 160 20 65 2.78 4.24
2vo4A02 77.16 2,4-D inducible glutathione S-transferaseGlycine max 1.20.1050.10 132 18 74 3.62 4.88
[1]
Displaying entries 1 to 12 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1dugA02
LGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDV
VLYMDPMCLDAFPKLVCFKKRIEAI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1dugA02
LGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDV
VLYMDPMCLDAFPKLVCFKKRIEAI
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:23

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"