Flow stage update by cuff on 08 Dec 2008 15:29
nice chopping
PDB Chain: 2rafB
2rafB
PDB 2raf, Chain B
CATH Domains (1)
| Domain ID | CATH code | Image |
|---|---|---|
| 2rafB01 | 3.40.50.720 |
Chain ATOM Sequence
>pdb|2rafB SDKIHHHHHHENLYFQGEITIFGKGNGQAIGHNFEIAGHEVTYYGSKDQATTLGEIVIAVPYPALAALAKQYATQLKGKI VVDITNPLNFDTWDDLVVPADSSAAQELQQQLPDSQVLKAFNTTFAATLQSGQVNGKEPTTVLVAGNDDSAKQRFTRALA DSPLEVKDAGKLKRARELEAGFQTLAASEQIGWTGGFAVVK
Chain History Events (89)
Chain chopped by cuff on 08 Dec 2008 15:29
nice chopping
Domchop review by cuff on 08 Dec 2008 14:37
Sending chopping (event 6862063) for review
Flow stage update by cuff on 08 Dec 2008 14:37
Sending chopping (event 6862063) for review
Domchop allotment by cuff on 08 Dec 2008 14:37
User 'cuff' has allocated a chain to themselves for DomChopping with comment : Grabbed this chain via DomChop's "Get Me A Chain" button.
Flow stage update by cuff on 08 Dec 2008 14:37
User 'cuff' has allocated a chain to themselves for DomChopping with comment : Grabbed this chain via DomChop's "Get Me A Chain" button.
Flow stage update by auto on 09 Oct 2008 08:36
Retrieved HMM(SAM) results for job ID SID1492495961697184 and inserted them into the database.
Chain chopping hmm by auto on 09 Oct 2008 08:36
Chain HMM chopping
Update comment by auto on 06 Oct 2008 11:29
HMM(SAM) job SID1492495961697184 is not yet finished.
Hmm submit by auto on 06 Oct 2008 11:17
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 06 Oct 2008 11:17
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 06 Oct 2008 08:41
Unable to retrieve "2rafB" HMM(SAM) results for job "SID1967624872018792"
Update comment by auto on 03 Oct 2008 05:34
HMM(SAM) job SID1967624872018792 is not yet finished.
Flow stage update by auto on 03 Oct 2008 05:22
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Hmm submit by auto on 03 Oct 2008 05:22
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Oct 2008 02:33
Unable to retrieve "2rafB" HMM(SAM) results for job "SID0478289924487750"
Update comment by auto on 02 Oct 2008 23:19
HMM(SAM) job SID0478289924487750 is not yet finished.
Flow stage update by auto on 02 Oct 2008 23:06
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Hmm submit by auto on 02 Oct 2008 23:06
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 20:09
Unable to retrieve "2rafB" HMM(SAM) results for job "SID9495551322770528"
Update comment by auto on 02 Oct 2008 17:25
HMM(SAM) job SID9495551322770528 is not yet finished.
Hmm submit by auto on 02 Oct 2008 17:11
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 17:11
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 14:13
Unable to retrieve "2rafB" HMM(SAM) results for job "SID8486858325054016"
Update comment by auto on 02 Oct 2008 11:16
HMM(SAM) job SID8486858325054016 is not yet finished.
Hmm submit by auto on 02 Oct 2008 11:07
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 11:07
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 08:28
Unable to retrieve "2rafB" HMM(SAM) results for job "SID5696170197503368"
Update comment by auto on 29 Sep 2008 05:30
HMM(SAM) job SID5696170197503368 is not yet finished.
Flow stage update by auto on 29 Sep 2008 05:28
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Hmm submit by auto on 29 Sep 2008 05:28
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 28 Sep 2008 23:29
Unable to retrieve "2rafB" HMM(SAM) results for job "SID7885257786650816"
Update comment by auto on 26 Sep 2008 17:16
HMM(SAM) job SID7885257786650816 is not yet finished.
Hmm submit by auto on 26 Sep 2008 17:15
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 17:15
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 14:14
Unable to retrieve "2rafB" HMM(SAM) results for job "SID4165084381930008"
Update comment by auto on 26 Sep 2008 11:45
HMM(SAM) job SID4165084381930008 is not yet finished.
Hmm submit by auto on 26 Sep 2008 11:44
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 11:44
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 08:26
Unable to retrieve "2rafB" HMM(SAM) results for job "SID8351935074364274"
Update comment by auto on 26 Sep 2008 05:29
HMM(SAM) job SID8351935074364274 is not yet finished.
Hmm submit by auto on 26 Sep 2008 05:27
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 05:27
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Sep 2008 02:35
Unable to retrieve "2rafB" HMM(SAM) results for job "SID4693720572268416"
Update comment by auto on 25 Sep 2008 23:17
HMM(SAM) job SID4693720572268416 is not yet finished.
Hmm submit by auto on 25 Sep 2008 23:15
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 23:15
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 20:13
Unable to retrieve "2rafB" HMM(SAM) results for job "SID7384534040907008"
Update comment by auto on 25 Sep 2008 17:17
HMM(SAM) job SID7384534040907008 is not yet finished.
Hmm submit by auto on 25 Sep 2008 17:15
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 17:15
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 14:17
Unable to retrieve "2rafB" HMM(SAM) results for job "SID0007110484538112"
Update comment by auto on 25 Sep 2008 11:30
HMM(SAM) job SID0007110484538112 is not yet finished.
Hmm submit by auto on 25 Sep 2008 11:28
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 11:28
The entry "2rafB" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Sep 2008 11:20
Retrieved "2rafB" CATHEDRAL results for job ID SID1475859710775624 and inserted them into the database.
Chain chopping cathedral by auto on 25 Sep 2008 11:20
Chain "2rafB" CATHEDRAL chopping from job SID1475859710775624
Update comment by auto on 25 Sep 2008 08:30
"2rafB" CATHEDRAL job SID1475859710775624 is not yet finished.
Cathedral submit by auto on 25 Sep 2008 08:27
The entry "2rafB" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 25 Sep 2008 08:27
The entry "2rafB" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 25 Sep 2008 08:24
ScanList with 12131 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2rafB.scanlist" for "2rafB"
Update comment by auto on 24 Sep 2008 23:10
Waiting for 4 new domains (example : 3cklA00) to be processed so that they can be scanned against too.
Update comment by auto on 24 Sep 2008 20:08
Waiting for 29 new domains (example : 3b8yB02) to be processed so that they can be scanned against too.
Update comment by auto on 24 Sep 2008 14:08
Waiting for 131 new domains (example : 2rhsB06) to be processed so that they can be scanned against too.
Update comment by auto on 24 Sep 2008 11:09
Waiting for 181 new domains (example : 2rdsA00) to be processed so that they can be scanned against too.
Update comment by auto on 24 Sep 2008 08:15
Waiting for 252 new domains (example : 2raeA01) to be processed so that they can be scanned against too.
Update comment by auto on 24 Sep 2008 02:25
Waiting for 283 new domains (example : 2r8cA02) to be processed so that they can be scanned against too.
Update comment by auto on 23 Sep 2008 23:10
Waiting for 343 new domains (example : 2r6vA01) to be processed so that they can be scanned against too.
Update comment by auto on 23 Sep 2008 20:08
Waiting for 399 new domains (example : 2qtqD00) to be processed so that they can be scanned against too.
Update comment by auto on 23 Sep 2008 17:07
Waiting for 461 new domains (example : 2o01A00) to be processed so that they can be scanned against too.
Update comment by auto on 23 Sep 2008 14:07
Waiting for 506 new domains (example : 2i6rA01) to be processed so that they can be scanned against too.
Update comment by auto on 22 Sep 2008 18:28
Waiting for 523 new domains (example : 1wmkA01) to be processed so that they can be scanned against too.
Update comment by auto on 22 Sep 2008 15:06
Waiting for 424 new domains (example : 2a0lA00) to be processed so that they can be scanned against too.
Chain chopping domak by auto on 22 Sep 2008 15:05
Chopping proposed by the "CHAIN_CHOPPING_DOMAK" algorithm
Chain chopping detective by auto on 22 Sep 2008 15:05
Chopping proposed by the "CHAIN_CHOPPING_DETECTIVE" algorithm
Chain chopping puu by auto on 22 Sep 2008 15:05
Chopping proposed by the "CHAIN_CHOPPING_PUU" algorithm
Flow stage update by auto on 22 Sep 2008 15:05
Added putative Choppings from the DBS that ran (CHAIN_CHOPPING_DETECTIVE, CHAIN_CHOPPING_DOMAK, CHAIN_CHOPPING_PUU) for Chain "2rafB"
Flow stage update by auto on 22 Sep 2008 15:04
Number of chains in ballcock flow stages is 99 which is less than the max allowed of 800
Flow stage update by auto on 22 Sep 2008 14:05
ChopClose result is not good enough for automatic chopping
Chain chopping chopclose by auto on 22 Sep 2008 14:05
Putative ChopClose added based on similarity with "2rafA"
Flow stage update by auto on 22 Sep 2008 13:57
No in_process hits for Chain "2rafB" ready to be processed
Update comment by auto on 23 Jul 2008 17:42
Chain "2rafB" hits Chain "2rafA" (97.3544973544974% over 90.4306220095694%) which is currently in process
Update comment by auto on 23 Nov 2007 10:08
Chain "2rafB" hits Chain "2rafA" (97.3544973544974% over 90.4306220095694%) which is currently in process
Flow stage update by auto on 23 Nov 2007 10:02
Chain "2rafB" hits Chain "2rafA" (97.3544973544974% over 90.4306220095694%) which is currently in process
Flow stage update by auto on 23 Nov 2007 10:00
NW result present for Chain "2rafB"
Flow stage update by auto on 23 Nov 2007 09:59
All required files are present for Chain "2rafB"
Flow stage update by auto on 12 Nov 2007 18:42
Beginning processing for Chain "2rafB"
Flow stage update by auto on 08 Nov 2007 03:26
Chain passed the SIFT criteria
Insertion by auto on 08 Nov 2007 03:21
Adding chain from chain pdb dir "/cath/data/current/chainpdb"
