Flow stage update by auto on 14 Jul 2007 20:26
Final ChopClose added based on similarity with "1k4cC"
PDB Chain: 2itcC
2itcC
PDB 2itc, Chain C
CATH Domains (1)
| Domain ID | CATH code | Image |
|---|---|---|
| 2itcC00 | 1.10.287.70 |
Chain ATOM Sequence
>pdb|2itcC SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGIT SFGLVTAALATWFVGREQERRGH
Chain History Events (14)
Chain chopped by auto on 14 Jul 2007 20:26
Final ChopClose added based on similarity with "1k4cC"
Chain chopping chopclose by auto on 14 Jul 2007 20:26
Putative ChopClose added based on similarity with "1k4cC"
Flow stage update by auto on 14 Jul 2007 20:06
No in_process hits for Chain "2itcC" ready to be processed
Update comment by auto on 14 Jul 2007 16:09
Chain "2itcC" hits Chain "2dweC" (100% over 100%) which is currently in process
Update comment by auto on 14 Jul 2007 10:09
Chain "2itcC" hits Chain "2dwdC" (100% over 100%) which is currently in process
Update comment by auto on 14 Jul 2007 04:06
Chain "2itcC" hits Chain "2hvjC" (100% over 100%) which is currently in process
Update comment by auto on 12 Jul 2007 20:58
Chain "2itcC" hits Chain "2hvkC" (100% over 100%) which is currently in process
Flow stage update by auto on 12 Jul 2007 20:49
Chain "2itcC" hits Chain "2hvkC" (100% over 100%) which is currently in process
Flow stage update by auto on 12 Jul 2007 20:36
NW result present for Chain "2itcC"
Flow stage update by auto on 12 Jul 2007 20:25
All required files are present for Chain "2itcC"
Flow stage update by auto on 12 Jul 2007 20:03
Beginning processing for Chain "2itcC"
Flow stage update by auto on 17 May 2007 20:32
Chain passed the SIFT criteria
Insertion by auto on 17 May 2007 20:32
Adding chain from chain pdb dir "/cath/data/current/chainpdb"
