Flow stage update by auto on 14 Jul 2007 16:33
Final ChopClose added based on similarity with "1k4cC"
PDB Chain: 2dweC
2dweC
PDB 2dwe, Chain C
CATH Domains (1)
| Domain ID | CATH code | Image |
|---|---|---|
| 2dweC00 | 1.10.287.70 |
Chain ATOM Sequence
>pdb|2dweC SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGIT SFGLVTAALATWFVGREQERRGH
Chain History Events (13)
Chain chopped by auto on 14 Jul 2007 16:33
Final ChopClose added based on similarity with "1k4cC"
Chain chopping chopclose by auto on 14 Jul 2007 16:33
Putative ChopClose added based on similarity with "1k4cC"
Flow stage update by auto on 14 Jul 2007 16:08
No in_process hits for Chain "2dweC" ready to be processed
Update comment by auto on 14 Jul 2007 10:08
Chain "2dweC" hits Chain "2dwdC" (100% over 100%) which is currently in process
Update comment by auto on 14 Jul 2007 04:06
Chain "2dweC" hits Chain "2hvjC" (100% over 100%) which is currently in process
Update comment by auto on 12 Jul 2007 20:57
Chain "2dweC" hits Chain "2hvkC" (100% over 100%) which is currently in process
Flow stage update by auto on 12 Jul 2007 20:48
Chain "2dweC" hits Chain "2hvkC" (100% over 100%) which is currently in process
Flow stage update by auto on 12 Jul 2007 20:36
NW result present for Chain "2dweC"
Flow stage update by auto on 12 Jul 2007 20:23
All required files are present for Chain "2dweC"
Flow stage update by auto on 12 Jul 2007 20:03
Beginning processing for Chain "2dweC"
Flow stage update by auto on 23 Feb 2007 17:32
Chain passed the SIFT criteria
Insertion by auto on 23 Feb 2007 17:22
Adding chain from chain pdb dir "/cath/data/current/chainpdb"
