PDB Chain: 2bobC

Molscript image for 2bobC
2bobC
PDB coordinates for chain 2bobC

PDB 2bob, Chain C

CATH Domains (1)

Domain IDCATH codeImage
2bobC00 1.10.287.70 Molscript image for 2bobC00

[top]
Domain boundaries for PDB chain 2bobC

Chopping figure for chain 2bobC
Domain IDStart ResStop Res NameLength
2bobC00 22 124 103

[top]
Chain ATOM Sequence 

>pdb|2bobC
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGIT
SFGLVTAALATWFVGREQERRGH
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|2bobC
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGIT
SFGLVTAALATWFVGREQERRGH
BLAST against CATH

[top]
Chain History Events (9)

Property update by auto on 14 Jul 2006 15:38

Updated the chain's properties [modified "seqres_md5_code" from "7049c32814278f361f0bf7e356f41132" to "af54955d5a2f7cf61d96cf25bdded68b"]

Flow stage update by auto on 10 Mar 2006 07:28

Final ChopClose added based on similarity with "1k4cC" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 97.65, SI: 100, SO: 100]

Chain chopped by auto on 10 Mar 2006 07:28

Final ChopClose added based on similarity with "1k4cC" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 97.65, SI: 100, SO: 100]

Chain chopping chopclose by auto on 10 Mar 2006 07:28

Putative ChopClose added based on similarity with "1k4cC" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 97.65, SI: 100, SO: 100]

Flow stage update by auto on 08 Mar 2006 14:28

NW result present for Chain "2bobC"

Flow stage update by auto on 08 Mar 2006 14:23

All required files are present for Chain "2bobC"

Flow stage update by auto on 08 Mar 2006 14:14

Beginning processing for Chain "2bobC"

Flow stage update by auto on 05 Mar 2006 14:22

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 14:16

Adding chain from chain pdb dir "/cath/data/cathv3/chainpdb"