# STOCKHOLM 1.0 #=GF ID 3.40.970.10/FF/000015 #=GF DE Ankyrin repeat and LEM domain-containing 2 #=GF AC 3.40.970.10/FF/000015 #=GF TP FunFam #=GF DR CATH: v4.3 #=GF DR DOPS: 0.000 #=GS A2CEB3/138-180 AC A2CEB3 #=GS A2CEB3/138-180 OS Danio rerio #=GS A2CEB3/138-180 DE Ankyrin repeat and LEM domain-containing 2 #=GS A2CEB3/138-180 DR ORG; Eukaryota; Metazoa; Chordata; Craniata; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Otomorpha; Ostariophysi; Cypriniphysae; Cypriniformes; Cyprinoidei; Cyprinidae; Danio; Danio rerio; #=GF SQ 1 A2CEB3/138-180 VLARNERAHVYTDKKEALQAVKMMKGARFKAFSNREDAEKFAK #=GC scorecons 0000000000000000000000000000000000000000000 #=GC scorecons_70 ___________________________________________ #=GC scorecons_80 ___________________________________________ #=GC scorecons_90 ___________________________________________ //