# STOCKHOLM 1.0 #=GF ID 4.10.970.10/FF/000013 #=GF DE Putative dna-binding subunit of a dna-dependent protein kinase ku70 autoantigen #=GF AC 4.10.970.10/FF/000013 #=GF TP FunFam #=GF DR CATH: v4.3 #=GF DR DOPS: 3.397 #=GS B7Q4R6/245-307 AC B7Q4R6 #=GS B7Q4R6/245-307 OS Ixodes scapularis #=GS B7Q4R6/245-307 DE Ku P70 DNA helicase, putative #=GS B7Q4R6/245-307 DR ORG; Eukaryota; Metazoa; Arthropoda; Chelicerata; Arachnida; Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes; Ixodes scapularis; #=GS A0A131Y1D3/243-305 AC A0A131Y1D3 #=GS A0A131Y1D3/243-305 OS Ixodes ricinus #=GS A0A131Y1D3/243-305 DE Putative dna-binding subunit of a dna-dependent protein kinase ku70 autoantigen #=GS A0A131Y1D3/243-305 DR ORG; Eukaryota; Metazoa; Arthropoda; Chelicerata; Arachnida; Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes; Ixodes ricinus; #=GF SQ 2 B7Q4R6/245-307 PTGKPFPVRLAKDTNEELLSRRLTYAQDNGEVLMPGDIAKCQEYGGKKALFDLSELKQMKAMA A0A131Y1D3/243-305 PTGKPFPIRLARDTNEELLSRRLTYAQDNGEVLMPGDIAKCQEYGGKKALFDLSELKQMKAMA #=GC scorecons 999999959995999999999999999999999999999999999999999999999999999 #=GC scorecons_70 *******_***_*************************************************** #=GC scorecons_80 *******_***_*************************************************** #=GC scorecons_90 *******_***_*************************************************** //