# STOCKHOLM 1.0 #=GF ID 3.10.20.90/FF/000955 #=GF DE FERM, ARH/RhoGEF and pleckstrin domain protein 2 #=GF AC 3.10.20.90/FF/000955 #=GF TP FunFam #=GF DR CATH: v4.3 #=GF DR DOPS: 0.000 #=GS F6SSP5/1-60 AC F6SSP5 #=GS F6SSP5/1-60 OS Xenopus tropicalis #=GS F6SSP5/1-60 DE FERM, ARH/RhoGEF and pleckstrin domain protein 2 #=GS F6SSP5/1-60 DR ORG; Eukaryota; Metazoa; Chordata; Craniata; Sarcopterygii; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana; Xenopus tropicalis; #=GF SQ 1 F6SSP5/1-60 KTTGQALLSQLFTHLNVVETDYFGIEFQTAQAQWVWLEPLKSVNKQLRKPKNAKLRLAVK #=GC scorecons 000000000000000000000000000000000000000000000000000000000000 #=GC scorecons_70 ____________________________________________________________ #=GC scorecons_80 ____________________________________________________________ #=GC scorecons_90 ____________________________________________________________ //