# STOCKHOLM 1.0
#=GF ID 1.10.10.10/FF/000179
#=GF DE DNA-binding response OmpR family regulator
#=GF AC 1.10.10.10/FF/000179
#=GF TP FunFam
#=GF DR CATH: v4.3
#=GF DR DOPS: 51.703
#=GS P0A4I1/125-217      AC P0A4I1
#=GS P0A4I1/125-217      OS Streptomyces coelicolor A3(2)
#=GS P0A4I1/125-217      DE Transcriptional regulatory protein CutR
#=GS P0A4I1/125-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albidoflavus group; Streptomyces coelicolor; 
#=GS Q8CJW1/128-224      AC Q8CJW1
#=GS Q8CJW1/128-224      OS Streptomyces coelicolor A3(2)
#=GS Q8CJW1/128-224      DE Putative two-component system response regulator
#=GS Q8CJW1/128-224      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albidoflavus group; Streptomyces coelicolor; 
#=GS A0A0N1FXR8/125-217  AC A0A0N1FXR8
#=GS A0A0N1FXR8/125-217  OS Actinobacteria bacterium OK074
#=GS A0A0N1FXR8/125-217  DE Two component transcriptional regulator, winged helix family
#=GS A0A0N1FXR8/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Actinobacteria bacterium OK074; 
#=GS A0A0N0N9C4/125-217  AC A0A0N0N9C4
#=GS A0A0N0N9C4/125-217  OS Actinobacteria bacterium OV320
#=GS A0A0N0N9C4/125-217  DE Two component transcriptional regulator, winged helix family
#=GS A0A0N0N9C4/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Actinobacteria bacterium OV320; 
#=GS A0A3R9SJU3/125-217  AC A0A3R9SJU3
#=GS A0A3R9SJU3/125-217  OS Streptomyces sp. WAC00469
#=GS A0A3R9SJU3/125-217  DE DNA-binding response regulator
#=GS A0A3R9SJU3/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC00469; 
#=GS A0A117PPU9/125-217  AC A0A117PPU9
#=GS A0A117PPU9/125-217  OS Streptomyces pseudovenezuelae
#=GS A0A117PPU9/125-217  DE Two-component system response regulator
#=GS A0A117PPU9/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces pseudovenezuelae; 
#=GS Q82KJ8/125-217      AC Q82KJ8
#=GS Q82KJ8/125-217      OS Streptomyces avermitilis MA-4680 = NBRC 14893
#=GS Q82KJ8/125-217      DE Putative two-component system response regulator
#=GS Q82KJ8/125-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces avermitilis; 
#=GS A0A1H5KBC7/125-217  AC A0A1H5KBC7
#=GS A0A1H5KBC7/125-217  OS Streptomyces sp. 3213.3
#=GS A0A1H5KBC7/125-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1H5KBC7/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 3213.3; 
#=GS A0A2A3GX35/125-217  AC A0A2A3GX35
#=GS A0A2A3GX35/125-217  OS Streptomyces sp. Tue6028
#=GS A0A2A3GX35/125-217  DE DNA-binding response regulator
#=GS A0A2A3GX35/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Tue6028; 
#=GS A0A1V1YZ03/125-217  AC A0A1V1YZ03
#=GS A0A1V1YZ03/125-217  OS Streptomyces sp. WAC00263
#=GS A0A1V1YZ03/125-217  DE DNA-binding response regulator
#=GS A0A1V1YZ03/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC00263; 
#=GS A0A2G9DM15/125-217  AC A0A2G9DM15
#=GS A0A2G9DM15/125-217  OS Streptomyces sp. JV178
#=GS A0A2G9DM15/125-217  DE DNA-binding response regulator
#=GS A0A2G9DM15/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. JV178; 
#=GS A0A3N1LSB9/125-217  AC A0A3N1LSB9
#=GS A0A3N1LSB9/125-217  OS Streptomyces ossamyceticus
#=GS A0A3N1LSB9/125-217  DE DNA-binding response OmpR family regulator
#=GS A0A3N1LSB9/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces ossamyceticus; 
#=GS L1KJA0/125-217      AC L1KJA0
#=GS L1KJA0/125-217      OS Streptomyces ipomoeae 91-03
#=GS L1KJA0/125-217      DE Transcriptional regulatory protein CutR
#=GS L1KJA0/125-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces ipomoeae; 
#=GS A0A2P9EV27/125-217  AC A0A2P9EV27
#=GS A0A2P9EV27/125-217  OS Streptomyces sp. MA5143a
#=GS A0A2P9EV27/125-217  DE Transcriptional regulatory protein TcrA
#=GS A0A2P9EV27/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. MA5143a; 
#=GS L8PLF3/125-217      AC L8PLF3
#=GS L8PLF3/125-217      OS Streptomyces viridochromogenes Tue57
#=GS L8PLF3/125-217      DE Putative Phosphate regulon transcriptional regulatory protein PhoB
#=GS L8PLF3/125-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces viridochromogenes; 
#=GS A0A117PC96/125-217  AC A0A117PC96
#=GS A0A117PC96/125-217  OS Streptomyces curacoi
#=GS A0A117PC96/125-217  DE Two-component system response regulator
#=GS A0A117PC96/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces curacoi; 
#=GS A0A0M8XLG6/115-207  AC A0A0M8XLG6
#=GS A0A0M8XLG6/115-207  OS Streptomyces sp. NRRL B-3648
#=GS A0A0M8XLG6/115-207  DE Transcriptional regulator
#=GS A0A0M8XLG6/115-207  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL B-3648; 
#=GS A0A0M8QMJ1/115-207  AC A0A0M8QMJ1
#=GS A0A0M8QMJ1/115-207  OS Streptomyces caelestis
#=GS A0A0M8QMJ1/115-207  DE Transcriptional regulator
#=GS A0A0M8QMJ1/115-207  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces caelestis; 
#=GS A0A250VHP9/206-298  AC A0A250VHP9
#=GS A0A250VHP9/206-298  OS Streptomyces olivochromogenes
#=GS A0A250VHP9/206-298  DE Transcriptional regulatory protein CutR
#=GS A0A250VHP9/206-298  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces olivochromogenes; 
#=GS A0A1U9QQR2/124-217  AC A0A1U9QQR2
#=GS A0A1U9QQR2/124-217  OS Streptomyces niveus
#=GS A0A1U9QQR2/124-217  DE DNA-binding response regulator
#=GS A0A1U9QQR2/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces niveus; 
#=GS A0A2D3UG49/124-217  AC A0A2D3UG49
#=GS A0A2D3UG49/124-217  OS Streptomyces peucetius subsp. caesius ATCC 27952
#=GS A0A2D3UG49/124-217  DE DNA-binding response regulator
#=GS A0A2D3UG49/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces peucetius; Streptomyces peucetius subsp. caesius; 
#=GS A0A0C5GIB2/125-217  AC A0A0C5GIB2
#=GS A0A0C5GIB2/125-217  OS Streptomyces cyaneogriseus subsp. noncyanogenus
#=GS A0A0C5GIB2/125-217  DE Transcriptional regulator
#=GS A0A0C5GIB2/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces cyaneogriseus; Streptomyces cyaneogriseus subsp. noncyanogenus; 
#=GS A0A1C4QJS5/125-217  AC A0A1C4QJS5
#=GS A0A1C4QJS5/125-217  OS Streptomyces sp. SolWspMP-5a-2
#=GS A0A1C4QJS5/125-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C4QJS5/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. SolWspMP-5a-2; 
#=GS D6K3J5/125-217      AC D6K3J5
#=GS D6K3J5/125-217      OS Streptomyces sp. e14
#=GS D6K3J5/125-217      DE Transcriptional regulatory protein CutR
#=GS D6K3J5/125-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. e14; 
#=GS A0A0B5ER74/125-217  AC A0A0B5ER74
#=GS A0A0B5ER74/125-217  OS Streptomyces albus subsp. albus DSM 41398
#=GS A0A0B5ER74/125-217  DE Two-component regulator CutR
#=GS A0A0B5ER74/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus; Streptomyces albus subsp. albus; 
#=GS A0A0M9ZHE5/115-207  AC A0A0M9ZHE5
#=GS A0A0M9ZHE5/115-207  OS Streptomyces sp. AS58
#=GS A0A0M9ZHE5/115-207  DE Transcriptional regulator
#=GS A0A0M9ZHE5/115-207  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. AS58; 
#=GS A0A0G3AD28/124-217  AC A0A0G3AD28
#=GS A0A0G3AD28/124-217  OS Streptomyces incarnatus
#=GS A0A0G3AD28/124-217  DE Transcriptional regulator
#=GS A0A0G3AD28/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces incarnatus; 
#=GS A0A3N4ZXQ2/124-217  AC A0A3N4ZXQ2
#=GS A0A3N4ZXQ2/124-217  OS Streptomyces sp. TLI_185
#=GS A0A3N4ZXQ2/124-217  DE DNA-binding response OmpR family regulator
#=GS A0A3N4ZXQ2/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. TLI_185; 
#=GS A0A3D9NR85/124-217  AC A0A3D9NR85
#=GS A0A3D9NR85/124-217  OS Streptomyces sp. 75
#=GS A0A3D9NR85/124-217  DE DNA-binding response OmpR family regulator
#=GS A0A3D9NR85/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 75; 
#=GS A0A1Z1WKV0/124-217  AC A0A1Z1WKV0
#=GS A0A1Z1WKV0/124-217  OS Streptomyces alboflavus
#=GS A0A1Z1WKV0/124-217  DE Putative transcriptional regulatory protein CutR
#=GS A0A1Z1WKV0/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces alboflavus; 
#=GS S3ZRE3/124-217      AC S3ZRE3
#=GS S3ZRE3/124-217      OS Streptomyces aurantiacus JA 4570
#=GS S3ZRE3/124-217      DE Putative transcriptional regulatory protein CutR
#=GS S3ZRE3/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces aurantiacus; 
#=GS A0A170X6K4/125-217  AC A0A170X6K4
#=GS A0A170X6K4/125-217  OS Streptomyces sp. F-3
#=GS A0A170X6K4/125-217  DE Transcriptional regulator
#=GS A0A170X6K4/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. F-3; 
#=GS A0A2M9IFP3/125-217  AC A0A2M9IFP3
#=GS A0A2M9IFP3/125-217  OS Streptomyces sp. CB01373
#=GS A0A2M9IFP3/125-217  DE DNA-binding response regulator
#=GS A0A2M9IFP3/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB01373; 
#=GS A0A124EC91/124-217  AC A0A124EC91
#=GS A0A124EC91/124-217  OS Streptomyces kanasensis
#=GS A0A124EC91/124-217  DE Two-component system response regulator
#=GS A0A124EC91/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces kanasensis; 
#=GS A0A365ZN80/125-217  AC A0A365ZN80
#=GS A0A365ZN80/125-217  OS Streptomyces sp. PT12
#=GS A0A365ZN80/125-217  DE DNA-binding response regulator
#=GS A0A365ZN80/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. PT12; 
#=GS A0A3A9W0R4/125-217  AC A0A3A9W0R4
#=GS A0A3A9W0R4/125-217  OS Streptomyces sp. AZ1-7
#=GS A0A3A9W0R4/125-217  DE DNA-binding response regulator
#=GS A0A3A9W0R4/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. AZ1-7; 
#=GS A0A1Q5MJT1/125-217  AC A0A1Q5MJT1
#=GS A0A1Q5MJT1/125-217  OS Streptomyces sp. CB02488
#=GS A0A1Q5MJT1/125-217  DE Transcriptional regulator
#=GS A0A1Q5MJT1/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB02488; 
#=GS A0A291QH18/124-217  AC A0A291QH18
#=GS A0A291QH18/124-217  OS Streptomyces formicae
#=GS A0A291QH18/124-217  DE Two-component system response regulator
#=GS A0A291QH18/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces formicae; 
#=GS A0A3Q8V4L7/124-217  AC A0A3Q8V4L7
#=GS A0A3Q8V4L7/124-217  OS Streptomyces sp. WAC 01529
#=GS A0A3Q8V4L7/124-217  DE DNA-binding response regulator
#=GS A0A3Q8V4L7/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC 01529; 
#=GS A0A3S2WMK0/124-217  AC A0A3S2WMK0
#=GS A0A3S2WMK0/124-217  OS Streptomyces sp. San01
#=GS A0A3S2WMK0/124-217  DE Response regulator transcription factor
#=GS A0A3S2WMK0/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. San01; 
#=GS A0A371XRH3/124-217  AC A0A371XRH3
#=GS A0A371XRH3/124-217  OS Streptomyces sp. AcE210
#=GS A0A371XRH3/124-217  DE DNA-binding response regulator
#=GS A0A371XRH3/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. AcE210; 
#=GS A0A1Q5LSM9/124-217  AC A0A1Q5LSM9
#=GS A0A1Q5LSM9/124-217  OS Streptomyces sp. CB03234
#=GS A0A1Q5LSM9/124-217  DE Transcriptional regulator
#=GS A0A1Q5LSM9/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB03234; 
#=GS A0A3R9Y672/124-217  AC A0A3R9Y672
#=GS A0A3R9Y672/124-217  OS Streptomyces sp. WAC05374
#=GS A0A3R9Y672/124-217  DE DNA-binding response regulator
#=GS A0A3R9Y672/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC05374; 
#=GS A0A0M9ZRS9/115-207  AC A0A0M9ZRS9
#=GS A0A0M9ZRS9/115-207  OS Streptomyces sp. NRRL WC-3618
#=GS A0A0M9ZRS9/115-207  DE Transcriptional regulator
#=GS A0A0M9ZRS9/115-207  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL WC-3618; 
#=GS F8JVT3/125-217      AC F8JVT3
#=GS F8JVT3/125-217      OS Streptomyces cattleya NRRL 8057 = DSM 46488
#=GS F8JVT3/125-217      DE Two-component regulator CutR
#=GS F8JVT3/125-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces cattleya; 
#=GS A0A1E7JHV6/124-217  AC A0A1E7JHV6
#=GS A0A1E7JHV6/124-217  OS Streptomyces abyssalis
#=GS A0A1E7JHV6/124-217  DE Transcriptional regulator
#=GS A0A1E7JHV6/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces abyssalis; 
#=GS A0A1E7KR89/124-217  AC A0A1E7KR89
#=GS A0A1E7KR89/124-217  OS Streptomyces nanshensis
#=GS A0A1E7KR89/124-217  DE Transcriptional regulator
#=GS A0A1E7KR89/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces nanshensis; 
#=GS A0A101NS44/124-217  AC A0A101NS44
#=GS A0A101NS44/124-217  OS Streptomyces yokosukanensis
#=GS A0A101NS44/124-217  DE Two-component system response regulator
#=GS A0A101NS44/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces yokosukanensis; 
#=GS A0A1R0LCU2/124-217  AC A0A1R0LCU2
#=GS A0A1R0LCU2/124-217  OS Streptomyces sp. IMTB 2501
#=GS A0A1R0LCU2/124-217  DE DNA-binding response regulator
#=GS A0A1R0LCU2/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. IMTB 2501; 
#=GS V6KZM2/124-217      AC V6KZM2
#=GS V6KZM2/124-217      OS Streptomyces roseochromogenus subsp. oscitans DS 12.976
#=GS V6KZM2/124-217      DE Transcriptional regulator
#=GS V6KZM2/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces roseochromogenus; Streptomyces roseochromogenus subsp. oscitans; 
#=GS A0A197SI20/125-217  AC A0A197SI20
#=GS A0A197SI20/125-217  OS Streptomyces sp. ERV7
#=GS A0A197SI20/125-217  DE DNA-binding response regulator
#=GS A0A197SI20/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. ERV7; 
#=GS A0A101S2X0/125-217  AC A0A101S2X0
#=GS A0A101S2X0/125-217  OS Streptomyces griseorubiginosus
#=GS A0A101S2X0/125-217  DE Transcriptional regulatory protein TcrA
#=GS A0A101S2X0/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseorubiginosus; 
#=GS A0A3N4U8D5/125-217  AC A0A3N4U8D5
#=GS A0A3N4U8D5/125-217  OS Streptomyces sp. W SAI-097
#=GS A0A3N4U8D5/125-217  DE DNA-binding response OmpR family regulator
#=GS A0A3N4U8D5/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. W SAI-097; 
#=GS A0A285CAB8/125-217  AC A0A285CAB8
#=GS A0A285CAB8/125-217  OS Streptomyces sp. TLI_55
#=GS A0A285CAB8/125-217  DE DNA-binding response OmpR family regulator
#=GS A0A285CAB8/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. TLI_55; 
#=GS A0A0X3UWZ1/125-217  AC A0A0X3UWZ1
#=GS A0A0X3UWZ1/125-217  OS Streptomyces regalis
#=GS A0A0X3UWZ1/125-217  DE Two-component system response regulator
#=GS A0A0X3UWZ1/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces regalis; 
#=GS A0A101UVI7/125-217  AC A0A101UVI7
#=GS A0A101UVI7/125-217  OS Streptomyces sp. RV15
#=GS A0A101UVI7/125-217  DE Two-component system response regulator
#=GS A0A101UVI7/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. RV15; 
#=GS A0A2U2ZRS4/125-217  AC A0A2U2ZRS4
#=GS A0A2U2ZRS4/125-217  OS Streptomyces sp. Act143
#=GS A0A2U2ZRS4/125-217  DE DNA-binding response regulator
#=GS A0A2U2ZRS4/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Act143; 
#=GS A0A1V4E1W5/125-217  AC A0A1V4E1W5
#=GS A0A1V4E1W5/125-217  OS Streptomyces sp. GKU 895
#=GS A0A1V4E1W5/125-217  DE DNA-binding response regulator
#=GS A0A1V4E1W5/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. GKU 895; 
#=GS A0A429HNA5/125-217  AC A0A429HNA5
#=GS A0A429HNA5/125-217  OS Streptomyces sp. WAC 05379
#=GS A0A429HNA5/125-217  DE DNA-binding response regulator
#=GS A0A429HNA5/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC 05379; 
#=GS A0A429B8D6/125-217  AC A0A429B8D6
#=GS A0A429B8D6/125-217  OS Streptomyces sp. WAC 01325
#=GS A0A429B8D6/125-217  DE DNA-binding response regulator
#=GS A0A429B8D6/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC 01325; 
#=GS A0A1H4ZKU8/125-217  AC A0A1H4ZKU8
#=GS A0A1H4ZKU8/125-217  OS Streptomyces sp. PAN_FS17
#=GS A0A1H4ZKU8/125-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1H4ZKU8/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. PAN_FS17; 
#=GS A0A401M9Y9/125-217  AC A0A401M9Y9
#=GS A0A401M9Y9/125-217  OS Streptomyces sp. NL15-2K
#=GS A0A401M9Y9/125-217  DE Two-component system response regulator
#=GS A0A401M9Y9/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NL15-2K; 
#=GS B5I2G9/125-217      AC B5I2G9
#=GS B5I2G9/125-217      OS Streptomyces sviceus ATCC 29083
#=GS B5I2G9/125-217      DE Phosphate regulon transcriptional regulatory protein PhoB
#=GS B5I2G9/125-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sviceus; 
#=GS A0A117Q9W5/125-217  AC A0A117Q9W5
#=GS A0A117Q9W5/125-217  OS Streptomyces antibioticus
#=GS A0A117Q9W5/125-217  DE Two-component system response regulator
#=GS A0A117Q9W5/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces antibioticus; 
#=GS A0A3S9I968/125-217  AC A0A3S9I968
#=GS A0A3S9I968/125-217  OS Streptomyces sp. GGCR-6
#=GS A0A3S9I968/125-217  DE Response regulator transcription factor
#=GS A0A3S9I968/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. GGCR-6; 
#=GS A0A3R8RXG0/125-217  AC A0A3R8RXG0
#=GS A0A3R8RXG0/125-217  OS Streptomyces sp. RP5T
#=GS A0A3R8RXG0/125-217  DE Response regulator transcription factor
#=GS A0A3R8RXG0/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. RP5T; 
#=GS A0A101U3I2/125-217  AC A0A101U3I2
#=GS A0A101U3I2/125-217  OS Streptomyces caeruleatus
#=GS A0A101U3I2/125-217  DE Two-component system response regulator
#=GS A0A101U3I2/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces caeruleatus; 
#=GS A0A3Q9ESB5/125-217  AC A0A3Q9ESB5
#=GS A0A3Q9ESB5/125-217  OS Streptomyces sp. MK-45
#=GS A0A3Q9ESB5/125-217  DE Response regulator transcription factor
#=GS A0A3Q9ESB5/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. MK-45; 
#=GS A0A0L8LI49/125-217  AC A0A0L8LI49
#=GS A0A0L8LI49/125-217  OS Streptomyces resistomycificus
#=GS A0A0L8LI49/125-217  DE Transcriptional regulator
#=GS A0A0L8LI49/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces resistomycificus; 
#=GS A0A2Z4IWI9/125-217  AC A0A2Z4IWI9
#=GS A0A2Z4IWI9/125-217  OS Streptomyces sp. ZFG47
#=GS A0A2Z4IWI9/125-217  DE DNA-binding response regulator
#=GS A0A2Z4IWI9/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. ZFG47; 
#=GS K4R1G7/125-217      AC K4R1G7
#=GS K4R1G7/125-217      OS Streptomyces davaonensis JCM 4913
#=GS K4R1G7/125-217      DE Transcriptional regulatory protein CutR
#=GS K4R1G7/125-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces davaonensis; 
#=GS A0A1H0P2U8/125-217  AC A0A1H0P2U8
#=GS A0A1H0P2U8/125-217  OS Streptomyces sp. cf386
#=GS A0A1H0P2U8/125-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1H0P2U8/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. cf386; 
#=GS A0A2A2Z1J0/125-217  AC A0A2A2Z1J0
#=GS A0A2A2Z1J0/125-217  OS Streptomyces sp. SA15
#=GS A0A2A2Z1J0/125-217  DE DNA-binding response regulator
#=GS A0A2A2Z1J0/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. SA15; 
#=GS A0A1A9BVI4/125-217  AC A0A1A9BVI4
#=GS A0A1A9BVI4/125-217  OS Streptomyces sp. DI166
#=GS A0A1A9BVI4/125-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1A9BVI4/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. DI166; 
#=GS A0A1B1MIR2/125-217  AC A0A1B1MIR2
#=GS A0A1B1MIR2/125-217  OS Streptomyces lincolnensis
#=GS A0A1B1MIR2/125-217  DE Two-component regulator
#=GS A0A1B1MIR2/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces lincolnensis; 
#=GS A0A2G5INC6/125-217  AC A0A2G5INC6
#=GS A0A2G5INC6/125-217  OS Streptomyces sp. HG99
#=GS A0A2G5INC6/125-217  DE DNA-binding response regulator
#=GS A0A2G5INC6/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. HG99; 
#=GS A0A2L2MHH8/125-217  AC A0A2L2MHH8
#=GS A0A2L2MHH8/125-217  OS Streptomyces dengpaensis
#=GS A0A2L2MHH8/125-217  DE DNA-binding response regulator
#=GS A0A2L2MHH8/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces dengpaensis; 
#=GS A0A2M9K1X9/124-217  AC A0A2M9K1X9
#=GS A0A2M9K1X9/124-217  OS Streptomyces sp. CB01635
#=GS A0A2M9K1X9/124-217  DE DNA-binding response regulator
#=GS A0A2M9K1X9/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB01635; 
#=GS A0A370BJW3/124-217  AC A0A370BJW3
#=GS A0A370BJW3/124-217  OS Streptomyces sp. AC230
#=GS A0A370BJW3/124-217  DE DNA-binding response regulator
#=GS A0A370BJW3/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. AC230; 
#=GS A0A2S9Q2U0/125-217  AC A0A2S9Q2U0
#=GS A0A2S9Q2U0/125-217  OS Streptomyces sp. ST5x
#=GS A0A2S9Q2U0/125-217  DE DNA-binding response regulator
#=GS A0A2S9Q2U0/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. ST5x; 
#=GS A0A0M2GVZ8/125-217  AC A0A0M2GVZ8
#=GS A0A0M2GVZ8/125-217  OS Streptomyces variegatus
#=GS A0A0M2GVZ8/125-217  DE Transcriptional regulator
#=GS A0A0M2GVZ8/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces variegatus; 
#=GS A0A160P4J4/125-217  AC A0A160P4J4
#=GS A0A160P4J4/125-217  OS Streptomyces laurentii
#=GS A0A160P4J4/125-217  DE Two-component system response regulator
#=GS A0A160P4J4/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces laurentii; 
#=GS A0A1V9WP04/125-217  AC A0A1V9WP04
#=GS A0A1V9WP04/125-217  OS Streptomyces sp. B9173
#=GS A0A1V9WP04/125-217  DE DNA-binding response regulator
#=GS A0A1V9WP04/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. B9173; 
#=GS A0A0T1T214/125-217  AC A0A0T1T214
#=GS A0A0T1T214/125-217  OS Streptomyces sp. Root1310
#=GS A0A0T1T214/125-217  DE Two-component system response regulator
#=GS A0A0T1T214/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Root1310; 
#=GS A0A1V6MVH4/125-217  AC A0A1V6MVH4
#=GS A0A1V6MVH4/125-217  OS Streptomyces phaeoluteigriseus
#=GS A0A1V6MVH4/125-217  DE DNA-binding response regulator
#=GS A0A1V6MVH4/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces phaeoluteigriseus; 
#=GS A0A3G2J9L1/124-217  AC A0A3G2J9L1
#=GS A0A3G2J9L1/124-217  OS Streptomyces sp. Z022
#=GS A0A3G2J9L1/124-217  DE DNA-binding response regulator
#=GS A0A3G2J9L1/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Z022; 
#=GS A0A2R4JER2/125-217  AC A0A2R4JER2
#=GS A0A2R4JER2/125-217  OS Streptomyces sp. P3
#=GS A0A2R4JER2/125-217  DE DNA-binding response regulator
#=GS A0A2R4JER2/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. P3; 
#=GS A0A428ZVG7/125-217  AC A0A428ZVG7
#=GS A0A428ZVG7/125-217  OS Streptomyces sp. WAC 01420
#=GS A0A428ZVG7/125-217  DE DNA-binding response regulator
#=GS A0A428ZVG7/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC 01420; 
#=GS A0A3S9ZAQ9/125-217  AC A0A3S9ZAQ9
#=GS A0A3S9ZAQ9/125-217  OS Streptomyces griseoviridis
#=GS A0A3S9ZAQ9/125-217  DE Response regulator transcription factor
#=GS A0A3S9ZAQ9/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseoviridis; 
#=GS A0A3M0I236/125-217  AC A0A3M0I236
#=GS A0A3M0I236/125-217  OS Streptomyces shenzhenensis
#=GS A0A3M0I236/125-217  DE DNA-binding response regulator
#=GS A0A3M0I236/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces shenzhenensis; 
#=GS A0A1X4HUM9/125-217  AC A0A1X4HUM9
#=GS A0A1X4HUM9/125-217  OS Streptomyces sp. 13-12-16
#=GS A0A1X4HUM9/125-217  DE DNA-binding response regulator
#=GS A0A1X4HUM9/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 13-12-16; 
#=GS A0A255PFB2/125-217  AC A0A255PFB2
#=GS A0A255PFB2/125-217  OS Streptomyces sp. FBKL.4005
#=GS A0A255PFB2/125-217  DE DNA-binding response regulator
#=GS A0A255PFB2/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. FBKL.4005; 
#=GS A0A0Q9AUW2/125-217  AC A0A0Q9AUW2
#=GS A0A0Q9AUW2/125-217  OS Streptomyces sp. Root264
#=GS A0A0Q9AUW2/125-217  DE Two-component system response regulator
#=GS A0A0Q9AUW2/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Root264; 
#=GS A0A3D9W8D2/125-217  AC A0A3D9W8D2
#=GS A0A3D9W8D2/125-217  OS Streptomyces sp. Ag82_O1-9
#=GS A0A3D9W8D2/125-217  DE DNA-binding response OmpR family regulator
#=GS A0A3D9W8D2/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ag82_O1-9; 
#=GS A0A0N0HSF4/125-217  AC A0A0N0HSF4
#=GS A0A0N0HSF4/125-217  OS Streptomyces sp. NRRL WC-3753
#=GS A0A0N0HSF4/125-217  DE Transcriptional regulator
#=GS A0A0N0HSF4/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL WC-3753; 
#=GS A0A0H4C6E4/125-217  AC A0A0H4C6E4
#=GS A0A0H4C6E4/125-217  OS Streptomyces sp. PBH53
#=GS A0A0H4C6E4/125-217  DE Transcriptional regulator
#=GS A0A0H4C6E4/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. PBH53; 
#=GS A0A1C5BJ02/125-217  AC A0A1C5BJ02
#=GS A0A1C5BJ02/125-217  OS Streptomyces sp. DconLS
#=GS A0A1C5BJ02/125-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C5BJ02/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. DconLS; 
#=GS A0A081XW39/125-217  AC A0A081XW39
#=GS A0A081XW39/125-217  OS Streptomyces toyocaensis
#=GS A0A081XW39/125-217  DE Transcriptional regulator
#=GS A0A081XW39/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces toyocaensis; 
#=GS A0A3R8WW40/125-217  AC A0A3R8WW40
#=GS A0A3R8WW40/125-217  OS Streptomyces griseofuscus
#=GS A0A3R8WW40/125-217  DE DNA-binding response regulator
#=GS A0A3R8WW40/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseofuscus; 
#=GS A0A0U5LX16/125-217  AC A0A0U5LX16
#=GS A0A0U5LX16/125-217  OS Streptomyces reticuli
#=GS A0A0U5LX16/125-217  DE Transcriptional regulatory protein TcrA
#=GS A0A0U5LX16/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces reticuli; 
#=GS A0A3Q8VA84/125-217  AC A0A3Q8VA84
#=GS A0A3Q8VA84/125-217  OS Streptomyces sp. WAC 01438
#=GS A0A3Q8VA84/125-217  DE DNA-binding response regulator
#=GS A0A3Q8VA84/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC 01438; 
#=GS H1Q6P9/125-217      AC H1Q6P9
#=GS H1Q6P9/125-217      OS Streptomyces coelicoflavus ZG0656
#=GS H1Q6P9/125-217      DE Two-component regulator CutR
#=GS H1Q6P9/125-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces coelicoflavus; 
#=GS A0A2N3TZF1/125-217  AC A0A2N3TZF1
#=GS A0A2N3TZF1/125-217  OS Streptomyces sp. 73
#=GS A0A2N3TZF1/125-217  DE DNA-binding response OmpR family regulator
#=GS A0A2N3TZF1/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 73; 
#=GS A0A286FGB9/125-217  AC A0A286FGB9
#=GS A0A286FGB9/125-217  OS Streptomyces sp. Ag109_G2-15
#=GS A0A286FGB9/125-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A286FGB9/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ag109_G2-15; 
#=GS A0A209CLN4/125-217  AC A0A209CLN4
#=GS A0A209CLN4/125-217  OS Streptomyces sp. CS159
#=GS A0A209CLN4/125-217  DE DNA-binding response regulator
#=GS A0A209CLN4/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CS159; 
#=GS S5VAZ8/125-217      AC S5VAZ8
#=GS S5VAZ8/125-217      OS Streptomyces collinus Tu 365
#=GS S5VAZ8/125-217      DE Two-component system response regulator
#=GS S5VAZ8/125-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces collinus; 
#=GS A0A089XGF6/125-217  AC A0A089XGF6
#=GS A0A089XGF6/125-217  OS Streptomyces glaucescens
#=GS A0A089XGF6/125-217  DE Transcriptional regulatory protein CutR
#=GS A0A089XGF6/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces glaucescens; 
#=GS A0A2G7F7F2/147-239  AC A0A2G7F7F2
#=GS A0A2G7F7F2/147-239  OS Streptomyces sp. 70
#=GS A0A2G7F7F2/147-239  DE DNA-binding response OmpR family regulator
#=GS A0A2G7F7F2/147-239  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 70; 
#=GS B5GUQ3/124-217      AC B5GUQ3
#=GS B5GUQ3/124-217      OS Streptomyces clavuligerus ATCC 27064
#=GS B5GUQ3/124-217      DE Transcriptional regulatory protein cutR
#=GS B5GUQ3/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces clavuligerus; 
#=GS A0A177I0J5/125-217  AC A0A177I0J5
#=GS A0A177I0J5/125-217  OS Streptomyces jeddahensis
#=GS A0A177I0J5/125-217  DE Transcriptional regulatory protein TcrA
#=GS A0A177I0J5/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces jeddahensis; 
#=GS D9XSI8/125-217      AC D9XSI8
#=GS D9XSI8/125-217      OS Streptomyces griseoflavus Tu4000
#=GS D9XSI8/125-217      DE Transcriptional regulatory protein CutR
#=GS D9XSI8/125-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseoflavus; 
#=GS A0A494V8B2/125-217  AC A0A494V8B2
#=GS A0A494V8B2/125-217  OS Streptomyces fungicidicus
#=GS A0A494V8B2/125-217  DE DNA-binding response regulator
#=GS A0A494V8B2/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces fungicidicus; 
#=GS A0A124C4B8/125-217  AC A0A124C4B8
#=GS A0A124C4B8/125-217  OS Streptomyces scabiei
#=GS A0A124C4B8/125-217  DE Transcriptional regulatory protein TcrA
#=GS A0A124C4B8/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces scabiei; 
#=GS A0A1D8SVT8/125-217  AC A0A1D8SVT8
#=GS A0A1D8SVT8/125-217  OS Streptomyces olivaceus
#=GS A0A1D8SVT8/125-217  DE DNA-binding response regulator
#=GS A0A1D8SVT8/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces olivaceus; 
#=GS A0A2P8PW09/125-217  AC A0A2P8PW09
#=GS A0A2P8PW09/125-217  OS Streptomyces sp. A217
#=GS A0A2P8PW09/125-217  DE DNA-binding response regulator
#=GS A0A2P8PW09/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. A217; 
#=GS L7EYG7/125-217      AC L7EYG7
#=GS L7EYG7/125-217      OS Streptomyces turgidiscabies Car8
#=GS L7EYG7/125-217      DE Transcriptional regulatory protein CutR
#=GS L7EYG7/125-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces turgidiscabies; 
#=GS A0A1Q4V688/124-217  AC A0A1Q4V688
#=GS A0A1Q4V688/124-217  OS Streptomyces uncialis
#=GS A0A1Q4V688/124-217  DE Transcriptional regulator
#=GS A0A1Q4V688/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces uncialis; 
#=GS A0A1C6PWJ4/124-217  AC A0A1C6PWJ4
#=GS A0A1C6PWJ4/124-217  OS Streptomyces sp. AmelKG-E11A
#=GS A0A1C6PWJ4/124-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C6PWJ4/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. AmelKG-E11A; 
#=GS A0A0M8TT16/143-235  AC A0A0M8TT16
#=GS A0A0M8TT16/143-235  OS Streptomyces sp. MMG1533
#=GS A0A0M8TT16/143-235  DE Transcriptional regulator
#=GS A0A0M8TT16/143-235  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. MMG1533; 
#=GS A0A327WN50/124-217  AC A0A327WN50
#=GS A0A327WN50/124-217  OS Streptomyces sp. PsTaAH-137
#=GS A0A327WN50/124-217  DE DNA-binding response OmpR family regulator
#=GS A0A327WN50/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. PsTaAH-137; 
#=GS A0A345HVI9/124-217  AC A0A345HVI9
#=GS A0A345HVI9/124-217  OS Streptomyces sp. GSSD-12
#=GS A0A345HVI9/124-217  DE DNA-binding response regulator
#=GS A0A345HVI9/124-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. GSSD-12; 
#=GS G2GJS6/125-217      AC G2GJS6
#=GS G2GJS6/125-217      OS Streptomyces zinciresistens K42
#=GS G2GJS6/125-217      DE Two-component system response regulator
#=GS G2GJS6/125-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces zinciresistens; 
#=GS A0A2M8MCT0/125-217  AC A0A2M8MCT0
#=GS A0A2M8MCT0/125-217  OS Streptomyces sp. TRM SA0054
#=GS A0A2M8MCT0/125-217  DE DNA-binding response regulator
#=GS A0A2M8MCT0/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. TRM SA0054; 
#=GS A0A022MPP0/125-217  AC A0A022MPP0
#=GS A0A022MPP0/125-217  OS Streptomyces sp. Tu 6176
#=GS A0A022MPP0/125-217  DE Transcriptional regulator
#=GS A0A022MPP0/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Tu 6176; 
#=GS A0A1A9J249/125-217  AC A0A1A9J249
#=GS A0A1A9J249/125-217  OS Streptomyces sp. SAT1
#=GS A0A1A9J249/125-217  DE DNA-binding response regulator
#=GS A0A1A9J249/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. SAT1; 
#=GS A0A231PJA3/125-217  AC A0A231PJA3
#=GS A0A231PJA3/125-217  OS Streptomyces sp. XY006
#=GS A0A231PJA3/125-217  DE DNA-binding response regulator
#=GS A0A231PJA3/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. XY006; 
#=GS A0A209C4Z7/125-217  AC A0A209C4Z7
#=GS A0A209C4Z7/125-217  OS Streptomyces sp. CS113
#=GS A0A209C4Z7/125-217  DE DNA-binding response regulator
#=GS A0A209C4Z7/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CS113; 
#=GS A0A3N4SNK7/125-217  AC A0A3N4SNK7
#=GS A0A3N4SNK7/125-217  OS Streptomyces sp. Ag109_O5-1
#=GS A0A3N4SNK7/125-217  DE DNA-binding response OmpR family regulator
#=GS A0A3N4SNK7/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ag109_O5-1; 
#=GS A0A2U9PA36/125-217  AC A0A2U9PA36
#=GS A0A2U9PA36/125-217  OS Streptomyces actuosus
#=GS A0A2U9PA36/125-217  DE DNA-binding response regulator
#=GS A0A2U9PA36/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces actuosus; 
#=GS A0A454W8Y0/125-217  AC A0A454W8Y0
#=GS A0A454W8Y0/125-217  OS Streptomyces sp. WAC02707
#=GS A0A454W8Y0/125-217  DE DNA-binding response regulator
#=GS A0A454W8Y0/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC02707; 
#=GS A0A1S2PLK3/125-217  AC A0A1S2PLK3
#=GS A0A1S2PLK3/125-217  OS Streptomyces sp. MUSC 14
#=GS A0A1S2PLK3/125-217  DE DNA-binding response regulator
#=GS A0A1S2PLK3/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. MUSC 14; 
#=GS A0A0J8DEY6/125-217  AC A0A0J8DEY6
#=GS A0A0J8DEY6/125-217  OS Streptomyces regensis
#=GS A0A0J8DEY6/125-217  DE Transcriptional regulator
#=GS A0A0J8DEY6/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces regensis; 
#=GS A0A3N1DT35/125-217  AC A0A3N1DT35
#=GS A0A3N1DT35/125-217  OS Streptomyces sp. E5N91 SAI-083
#=GS A0A3N1DT35/125-217  DE DNA-binding response OmpR family regulator
#=GS A0A3N1DT35/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. E5N91 SAI-083; 
#=GS A0A2G6ZYQ7/125-217  AC A0A2G6ZYQ7
#=GS A0A2G6ZYQ7/125-217  OS Streptomyces sp. 1121.2
#=GS A0A2G6ZYQ7/125-217  DE DNA-binding response OmpR family regulator
#=GS A0A2G6ZYQ7/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 1121.2; 
#=GS A0A270QUV4/125-217  AC A0A270QUV4
#=GS A0A270QUV4/125-217  OS Streptomyces sp. Alain-F2R5
#=GS A0A270QUV4/125-217  DE DNA-binding response regulator
#=GS A0A270QUV4/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Alain-F2R5; 
#=GS A0A1M5WGZ6/125-217  AC A0A1M5WGZ6
#=GS A0A1M5WGZ6/125-217  OS Streptomyces sp. 3214.6
#=GS A0A1M5WGZ6/125-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1M5WGZ6/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 3214.6; 
#=GS A0A2S1IK59/125-217  AC A0A2S1IK59
#=GS A0A2S1IK59/125-217  OS Streptomyces nigra
#=GS A0A2S1IK59/125-217  DE DNA-binding response regulator
#=GS A0A2S1IK59/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces nigra; 
#=GS A0A3E0GPQ7/125-217  AC A0A3E0GPQ7
#=GS A0A3E0GPQ7/125-217  OS Streptomyces sp. 2221.1
#=GS A0A3E0GPQ7/125-217  DE DNA-binding response OmpR family regulator
#=GS A0A3E0GPQ7/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 2221.1; 
#=GS A0A1H5IMT2/125-217  AC A0A1H5IMT2
#=GS A0A1H5IMT2/125-217  OS Streptomyces sp. Ag109_O5-10
#=GS A0A1H5IMT2/125-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1H5IMT2/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ag109_O5-10; 
#=GS A0A076M543/125-217  AC A0A076M543
#=GS A0A076M543/125-217  OS Streptomyces lividans TK24
#=GS A0A076M543/125-217  DE Transcriptional regulatory protein CutR
#=GS A0A076M543/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces lividans; 
#=GS A0A066Y8S6/125-217  AC A0A066Y8S6
#=GS A0A066Y8S6/125-217  OS Streptomyces olindensis
#=GS A0A066Y8S6/125-217  DE Transcriptional regulator
#=GS A0A066Y8S6/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces olindensis; 
#=GS A0A2Z5K904/125-217  AC A0A2Z5K904
#=GS A0A2Z5K904/125-217  OS Streptomyces sp. Go-475
#=GS A0A2Z5K904/125-217  DE Transcriptional regulatory protein TcrA
#=GS A0A2Z5K904/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Go-475; 
#=GS A0A1H5DEX1/125-217  AC A0A1H5DEX1
#=GS A0A1H5DEX1/125-217  OS Streptomyces misionensis
#=GS A0A1H5DEX1/125-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1H5DEX1/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces misionensis; 
#=GS A0A0X3XPV6/125-217  AC A0A0X3XPV6
#=GS A0A0X3XPV6/125-217  OS Streptomyces sp. NRRL WC-3605
#=GS A0A0X3XPV6/125-217  DE Two-component system response regulator
#=GS A0A0X3XPV6/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL WC-3605; 
#=GS A0A0N6ZHT0/125-217  AC A0A0N6ZHT0
#=GS A0A0N6ZHT0/125-217  OS Streptomyces sp. CCM_MD2014
#=GS A0A0N6ZHT0/125-217  DE Transcriptional regulator
#=GS A0A0N6ZHT0/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CCM_MD2014; 
#=GS A0A2N9B5C8/125-217  AC A0A2N9B5C8
#=GS A0A2N9B5C8/125-217  OS Streptomyces chartreusis NRRL 3882
#=GS A0A2N9B5C8/125-217  DE Transcriptional regulatory protein TcrA
#=GS A0A2N9B5C8/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces chartreusis; 
#=GS A0A2N3XIS0/125-217  AC A0A2N3XIS0
#=GS A0A2N3XIS0/125-217  OS Streptomyces sp. 5112.2
#=GS A0A2N3XIS0/125-217  DE DNA-binding response OmpR family regulator
#=GS A0A2N3XIS0/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 5112.2; 
#=GS A0A1B1ATW1/125-217  AC A0A1B1ATW1
#=GS A0A1B1ATW1/125-217  OS Streptomyces griseochromogenes
#=GS A0A1B1ATW1/125-217  DE DNA-binding response regulator
#=GS A0A1B1ATW1/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseochromogenes; 
#=GS A0A0K2B0E1/125-217  AC A0A0K2B0E1
#=GS A0A0K2B0E1/125-217  OS Streptomyces ambofaciens ATCC 23877
#=GS A0A0K2B0E1/125-217  DE Transcriptional regulatory protein CutR
#=GS A0A0K2B0E1/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces ambofaciens; 
#=GS A0A0K8PLA1/125-217  AC A0A0K8PLA1
#=GS A0A0K8PLA1/125-217  OS Streptomyces azureus
#=GS A0A0K8PLA1/125-217  DE Two-component system response regulator
#=GS A0A0K8PLA1/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces azureus; 
#=GS A0A3N1HUE3/125-217  AC A0A3N1HUE3
#=GS A0A3N1HUE3/125-217  OS Streptomyces sp. PanSC9
#=GS A0A3N1HUE3/125-217  DE DNA-binding response OmpR family regulator
#=GS A0A3N1HUE3/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. PanSC9; 
#=GS A0A429NMW1/125-217  AC A0A429NMW1
#=GS A0A429NMW1/125-217  OS Streptomyces sp. WAC08401
#=GS A0A429NMW1/125-217  DE DNA-binding response regulator
#=GS A0A429NMW1/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC08401; 
#=GS A0A1R1WG71/125-217  AC A0A1R1WG71
#=GS A0A1R1WG71/125-217  OS Streptomyces sp. M1013
#=GS A0A1R1WG71/125-217  DE DNA-binding response regulator
#=GS A0A1R1WG71/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. M1013; 
#=GS A0A101Q202/125-217  AC A0A101Q202
#=GS A0A101Q202/125-217  OS Streptomyces corchorusii
#=GS A0A101Q202/125-217  DE Two-component system response regulator
#=GS A0A101Q202/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces corchorusii; 
#=GS A0A397QCE1/125-217  AC A0A397QCE1
#=GS A0A397QCE1/125-217  OS Streptomyces sp. 19
#=GS A0A397QCE1/125-217  DE DNA-binding response OmpR family regulator
#=GS A0A397QCE1/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 19; 
#=GS A0A269U2Y8/125-217  AC A0A269U2Y8
#=GS A0A269U2Y8/125-217  OS Streptomyces sp. alain-838
#=GS A0A269U2Y8/125-217  DE DNA-binding response regulator
#=GS A0A269U2Y8/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. alain-838; 
#=GS A0A1Q5L6B9/125-217  AC A0A1Q5L6B9
#=GS A0A1Q5L6B9/125-217  OS Streptomyces sp. TSRI0107
#=GS A0A1Q5L6B9/125-217  DE Transcriptional regulator
#=GS A0A1Q5L6B9/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. TSRI0107; 
#=GS A0A2W6Q8L3/125-217  AC A0A2W6Q8L3
#=GS A0A2W6Q8L3/125-217  OS Streptomyces sp. SW4
#=GS A0A2W6Q8L3/125-217  DE DNA-binding response regulator
#=GS A0A2W6Q8L3/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. SW4; 
#=GS A0A429FRI3/125-217  AC A0A429FRI3
#=GS A0A429FRI3/125-217  OS Streptomyces sp. WAC 04229
#=GS A0A429FRI3/125-217  DE DNA-binding response regulator
#=GS A0A429FRI3/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC 04229; 
#=GS A0A2P8AHB7/125-217  AC A0A2P8AHB7
#=GS A0A2P8AHB7/125-217  OS Streptomyces sp. 111WW2
#=GS A0A2P8AHB7/125-217  DE Transcriptional regulatory protein TcrA
#=GS A0A2P8AHB7/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 111WW2; 
#=GS A0A2S6XEE1/125-217  AC A0A2S6XEE1
#=GS A0A2S6XEE1/125-217  OS Streptomyces sp. MH60
#=GS A0A2S6XEE1/125-217  DE Transcriptional regulatory protein TcrA
#=GS A0A2S6XEE1/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. MH60; 
#=GS A0A2S4ZEV2/125-217  AC A0A2S4ZEV2
#=GS A0A2S4ZEV2/125-217  OS Streptomyces sp. Ru62
#=GS A0A2S4ZEV2/125-217  DE DNA-binding response regulator
#=GS A0A2S4ZEV2/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ru62; 
#=GS A0A3N4V382/125-217  AC A0A3N4V382
#=GS A0A3N4V382/125-217  OS Streptomyces sp. Ag82_G5-5
#=GS A0A3N4V382/125-217  DE DNA-binding response OmpR family regulator
#=GS A0A3N4V382/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ag82_G5-5; 
#=GS A0A1C4SU15/125-217  AC A0A1C4SU15
#=GS A0A1C4SU15/125-217  OS Streptomyces sp. di188
#=GS A0A1C4SU15/125-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C4SU15/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. di188; 
#=GS A0A286CQA8/125-217  AC A0A286CQA8
#=GS A0A286CQA8/125-217  OS Streptomyces sp. Ag82_G6-1
#=GS A0A286CQA8/125-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A286CQA8/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ag82_G6-1; 
#=GS A0A1S2PYG0/125-217  AC A0A1S2PYG0
#=GS A0A1S2PYG0/125-217  OS Streptomyces sp. MUSC 1
#=GS A0A1S2PYG0/125-217  DE DNA-binding response regulator
#=GS A0A1S2PYG0/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. MUSC 1; 
#=GS A0A1H2D2U4/125-217  AC A0A1H2D2U4
#=GS A0A1H2D2U4/125-217  OS Streptomyces sp. 2114.2
#=GS A0A1H2D2U4/125-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1H2D2U4/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 2114.2; 
#=GS A0A0S2P7K2/125-217  AC A0A0S2P7K2
#=GS A0A0S2P7K2/125-217  OS Streptomyces hygroscopicus subsp. limoneus
#=GS A0A0S2P7K2/125-217  DE Transcriptional regulatory protein CutR
#=GS A0A0S2P7K2/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces hygroscopicus; Streptomyces hygroscopicus subsp. limoneus; 
#=GS A0A346C7V1/125-217  AC A0A346C7V1
#=GS A0A346C7V1/125-217  OS Streptomyces sp. CB09001
#=GS A0A346C7V1/125-217  DE DNA-binding response regulator
#=GS A0A346C7V1/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB09001; 
#=GS A0A0U3QD64/125-217  AC A0A0U3QD64
#=GS A0A0U3QD64/125-217  OS Streptomyces sp. 4F
#=GS A0A0U3QD64/125-217  DE DNA-binding response regulator
#=GS A0A0U3QD64/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 4F; 
#=GS A0A1J4NXS7/125-217  AC A0A1J4NXS7
#=GS A0A1J4NXS7/125-217  OS Streptomyces mangrovisoli
#=GS A0A1J4NXS7/125-217  DE DNA-binding response regulator
#=GS A0A1J4NXS7/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces mangrovisoli; 
#=GS M3CXS2/125-217      AC M3CXS2
#=GS M3CXS2/125-217      OS Streptomyces gancidicus BKS 13-15
#=GS M3CXS2/125-217      DE Two-component system response regulator
#=GS M3CXS2/125-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces gancidicus; 
#=GS A0A143C7J7/125-217  AC A0A143C7J7
#=GS A0A143C7J7/125-217  OS Streptomyces qaidamensis
#=GS A0A143C7J7/125-217  DE DNA-binding response regulator
#=GS A0A143C7J7/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces qaidamensis; 
#=GS A0A117PUZ9/125-217  AC A0A117PUZ9
#=GS A0A117PUZ9/125-217  OS Streptomyces cellostaticus
#=GS A0A117PUZ9/125-217  DE Two-component system response regulator
#=GS A0A117PUZ9/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces cellostaticus; 
#=GS A0A2N8TFS0/125-217  AC A0A2N8TFS0
#=GS A0A2N8TFS0/125-217  OS Streptomyces sp. 13K301
#=GS A0A2N8TFS0/125-217  DE DNA-binding response regulator
#=GS A0A2N8TFS0/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 13K301; 
#=GS A0A421PC53/125-217  AC A0A421PC53
#=GS A0A421PC53/125-217  OS Streptomyces sp. ZS0098
#=GS A0A421PC53/125-217  DE DNA-binding response regulator
#=GS A0A421PC53/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. ZS0098; 
#=GS A0A1H9MTR5/125-217  AC A0A1H9MTR5
#=GS A0A1H9MTR5/125-217  OS Streptomyces sp. yr375
#=GS A0A1H9MTR5/125-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1H9MTR5/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. yr375; 
#=GS A0A1K2FW94/125-217  AC A0A1K2FW94
#=GS A0A1K2FW94/125-217  OS Streptomyces sp. F-1
#=GS A0A1K2FW94/125-217  DE Transcriptional regulatory protein TcrA
#=GS A0A1K2FW94/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. F-1; 
#=GS A0A2U2F004/125-217  AC A0A2U2F004
#=GS A0A2U2F004/125-217  OS Streptomyces sp. SMS_SU21
#=GS A0A2U2F004/125-217  DE DNA-binding response regulator
#=GS A0A2U2F004/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. SMS_SU21; 
#=GS A0A2T4NAD3/125-217  AC A0A2T4NAD3
#=GS A0A2T4NAD3/125-217  OS Streptomyces sp. A244
#=GS A0A2T4NAD3/125-217  DE DNA-binding response regulator
#=GS A0A2T4NAD3/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. A244; 
#=GS A0A399CK67/125-217  AC A0A399CK67
#=GS A0A399CK67/125-217  OS Streptomyces sp. SHP22-7
#=GS A0A399CK67/125-217  DE DNA-binding response regulator
#=GS A0A399CK67/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. SHP22-7; 
#=GS A0A086MWK0/125-217  AC A0A086MWK0
#=GS A0A086MWK0/125-217  OS Streptomyces luteus
#=GS A0A086MWK0/125-217  DE Transcriptional regulator
#=GS A0A086MWK0/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces luteus; 
#=GS A0A176KV54/125-217  AC A0A176KV54
#=GS A0A176KV54/125-217  OS Streptomyces sp. FXJ1.172
#=GS A0A176KV54/125-217  DE DNA-binding response regulator
#=GS A0A176KV54/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. FXJ1.172; 
#=GS A0A3Q8VRT6/125-217  AC A0A3Q8VRT6
#=GS A0A3Q8VRT6/125-217  OS Streptomyces sp. KPB2
#=GS A0A3Q8VRT6/125-217  DE DNA-binding response regulator
#=GS A0A3Q8VRT6/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. KPB2; 
#=GS A0A221P4C7/125-217  AC A0A221P4C7
#=GS A0A221P4C7/125-217  OS Streptomyces pluripotens
#=GS A0A221P4C7/125-217  DE DNA-binding response regulator
#=GS A0A221P4C7/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces pluripotens; 
#=GS A0A243S0Q0/125-217  AC A0A243S0Q0
#=GS A0A243S0Q0/125-217  OS Streptomyces swartbergensis
#=GS A0A243S0Q0/125-217  DE DNA-binding response regulator
#=GS A0A243S0Q0/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces swartbergensis; 
#=GS A0A1Q5C088/125-217  AC A0A1Q5C088
#=GS A0A1Q5C088/125-217  OS Streptomyces sp. CB02414
#=GS A0A1Q5C088/125-217  DE Transcriptional regulator
#=GS A0A1Q5C088/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB02414; 
#=GS A0A1Q5MGW4/125-217  AC A0A1Q5MGW4
#=GS A0A1Q5MGW4/125-217  OS Streptomyces sp. CB02400
#=GS A0A1Q5MGW4/125-217  DE Transcriptional regulator
#=GS A0A1Q5MGW4/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB02400; 
#=GS A0A1H5EDC4/125-217  AC A0A1H5EDC4
#=GS A0A1H5EDC4/125-217  OS Streptomyces sp. 2231.1
#=GS A0A1H5EDC4/125-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1H5EDC4/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 2231.1; 
#=GS A0A124I585/125-217  AC A0A124I585
#=GS A0A124I585/125-217  OS Streptomyces griseoruber
#=GS A0A124I585/125-217  DE Two-component system response regulator
#=GS A0A124I585/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseoruber; 
#=GS A0A1Q5KES9/125-217  AC A0A1Q5KES9
#=GS A0A1Q5KES9/125-217  OS Streptomyces sp. CB01883
#=GS A0A1Q5KES9/125-217  DE Transcriptional regulator
#=GS A0A1Q5KES9/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB01883; 
#=GS A0A370W2R9/125-217  AC A0A370W2R9
#=GS A0A370W2R9/125-217  OS Streptomyces sp. M7
#=GS A0A370W2R9/125-217  DE DNA-binding response regulator
#=GS A0A370W2R9/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. M7; 
#=GS A0A345TLS1/125-217  AC A0A345TLS1
#=GS A0A345TLS1/125-217  OS Streptomyces sp. ETH9427
#=GS A0A345TLS1/125-217  DE DNA-binding response regulator
#=GS A0A345TLS1/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. ETH9427; 
#=GS A0A1X7GYU3/125-217  AC A0A1X7GYU3
#=GS A0A1X7GYU3/125-217  OS Streptomyces sp. Amel2xC10
#=GS A0A1X7GYU3/125-217  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1X7GYU3/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Amel2xC10; 
#=GS A0A101SRF8/125-217  AC A0A101SRF8
#=GS A0A101SRF8/125-217  OS Streptomyces bungoensis
#=GS A0A101SRF8/125-217  DE Two-component system response regulator
#=GS A0A101SRF8/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces bungoensis; 
#=GS A0A101R1M9/125-217  AC A0A101R1M9
#=GS A0A101R1M9/125-217  OS Streptomyces longwoodensis
#=GS A0A101R1M9/125-217  DE Two-component system response regulator
#=GS A0A101R1M9/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces longwoodensis; 
#=GS A0A2S2GJC8/128-220  AC A0A2S2GJC8
#=GS A0A2S2GJC8/128-220  OS Streptomyces sp. SM18
#=GS A0A2S2GJC8/128-220  DE DNA-binding response regulator
#=GS A0A2S2GJC8/128-220  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. SM18; 
#=GS H2K2C0/125-217      AC H2K2C0
#=GS H2K2C0/125-217      OS Streptomyces hygroscopicus subsp. jinggangensis 5008
#=GS H2K2C0/125-217      DE Two-component system response regulator
#=GS H2K2C0/125-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces hygroscopicus; Streptomyces hygroscopicus subsp. jinggangensis; 
#=GS V6KFA8/124-217      AC V6KFA8
#=GS V6KFA8/124-217      OS Streptomyces niveus NCIMB 11891
#=GS V6KFA8/124-217      DE Transcriptional regulator
#=GS V6KFA8/124-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces niveus; 
#=GS A0A0J7ZJH9/125-217  AC A0A0J7ZJH9
#=GS A0A0J7ZJH9/125-217  OS Streptomyces viridochromogenes
#=GS A0A0J7ZJH9/125-217  DE Transcriptional regulator
#=GS A0A0J7ZJH9/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces viridochromogenes; 
#=GS C9Z0H0/125-217      AC C9Z0H0
#=GS C9Z0H0/125-217      OS Streptomyces scabiei 87.22
#=GS C9Z0H0/125-217      DE Two-component response regulator
#=GS C9Z0H0/125-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces scabiei; 
#=GS D9WZ77/125-217      AC D9WZ77
#=GS D9WZ77/125-217      OS Streptomyces viridochromogenes DSM 40736
#=GS D9WZ77/125-217      DE Phosphate regulon transcriptional regulatory protein PhoB
#=GS D9WZ77/125-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces viridochromogenes; 
#=GS A0A0L8NEU3/125-217  AC A0A0L8NEU3
#=GS A0A0L8NEU3/125-217  OS Streptomyces antibioticus
#=GS A0A0L8NEU3/125-217  DE Transcriptional regulator
#=GS A0A0L8NEU3/125-217  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces antibioticus; 
#=GS P0A4I2/125-217      AC P0A4I2
#=GS P0A4I2/125-217      OS Streptomyces lividans
#=GS P0A4I2/125-217      DE Transcriptional regulatory protein CutR
#=GS P0A4I2/125-217      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces lividans; 
#=GS A0A3E0GID0/128-224  AC A0A3E0GID0
#=GS A0A3E0GID0/128-224  OS Streptomyces sp. 2221.1
#=GS A0A3E0GID0/128-224  DE Two-component system response regulator VanR
#=GS A0A3E0GID0/128-224  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 2221.1; 
#=GS A0A076MBM4/128-224  AC A0A076MBM4
#=GS A0A076MBM4/128-224  OS Streptomyces lividans TK24
#=GS A0A076MBM4/128-224  DE Transcriptional regulatory protein
#=GS A0A076MBM4/128-224  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces lividans; 
#=GS A0A1H2BPT7/128-224  AC A0A1H2BPT7
#=GS A0A1H2BPT7/128-224  OS Streptomyces sp. 2114.2
#=GS A0A1H2BPT7/128-224  DE Two-component system, OmpR family, response regulator VanR
#=GS A0A1H2BPT7/128-224  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 2114.2; 
#=GS A0A397QMW9/128-224  AC A0A397QMW9
#=GS A0A397QMW9/128-224  OS Streptomyces sp. 19
#=GS A0A397QMW9/128-224  DE Two-component system response regulator VanR
#=GS A0A397QMW9/128-224  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 19; 
#=GS A0A0G3ASV0/128-223  AC A0A0G3ASV0
#=GS A0A0G3ASV0/128-223  OS Streptomyces incarnatus
#=GS A0A0G3ASV0/128-223  DE Transcriptional regulator
#=GS A0A0G3ASV0/128-223  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces incarnatus; 
#=GF SQ 209
P0A4I1/125-217              -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
Q8CJW1/128-224              ----EIAGLRLDPFRREVYRGGRYVALTRKQFAVLEVLVAAEGGVVSAEELLERAWDENADPFTNAVRITVSALRKRLGEPGIIATVPGVGYRIDTAPVSE
A0A0N1FXR8/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0N0N9C4/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A3R9SJU3/125-217          -PVLERAGIRLDPNRREVFRDGREVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A117PPU9/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
Q82KJ8/125-217              -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1H5KBC7/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2A3GX35/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1V1YZ03/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2G9DM15/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A3N1LSB9/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
L1KJA0/125-217              -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2P9EV27/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
L8PLF3/125-217              -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A117PC96/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0M8XLG6/115-207          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0M8QMJ1/115-207          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A250VHP9/206-298          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1U9QQR2/124-217          PPVLERSGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2D3UG49/124-217          PPVLERAGIKLDPNRREVFRDSKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0C5GIB2/125-217          -PVLERAGIKLDPNRREVFRDGREIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1C4QJS5/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
D6K3J5/125-217              -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0B5ER74/125-217          -PVLERAGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI-------
A0A0M9ZHE5/115-207          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0G3AD28/124-217          PPVLERAGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A3N4ZXQ2/124-217          PPVLERAGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A3D9NR85/124-217          PPVLERAGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1Z1WKV0/124-217          PPVLERAGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI-------
S3ZRE3/124-217              PPVLERAGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI-------
A0A170X6K4/125-217          -PVLERAGIKLDPNRREVFRDGREVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2M9IFP3/125-217          -PVLERAGIKLDPNRREVFRDGREVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A124EC91/124-217          PPVLERAGIKLDPNRREVFRDGREIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIITVPGSGYRI-------
A0A365ZN80/125-217          -PVLERSGITLDPNRREVRRDGREISLAPKEFAVLDVLMRSEGAVVSAEQLLEKAWDENADPFTNVVRVTVMTLRRKLGDPPVITTVPGAGYRI-------
A0A3A9W0R4/125-217          -PVLERSGITLDPNRREVRRDGREISLAPKEFAVLDVLMRSEGAVVSAEQLLEKAWDENADPFTNVVRVTVMTLRRKLGDPPVITTVPGAGYRI-------
A0A1Q5MJT1/125-217          -PVLERAGIKLDPNRREVFRGDQEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A291QH18/124-217          PPVLERAGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI-------
A0A3Q8V4L7/124-217          PPVLERAGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI-------
A0A3S2WMK0/124-217          PPVLERAGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI-------
A0A371XRH3/124-217          PPVLERAGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI-------
A0A1Q5LSM9/124-217          PPVLERAGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A3R9Y672/124-217          PPVLERAGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0M9ZRS9/115-207          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
F8JVT3/125-217              -PVLERAGIKLDPNRREVFRDGREVHLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1E7JHV6/124-217          PPVLERAGIRLDPNRREVFRNGSEIQLAPKEFAVLEVLMRGEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVILTVPGAGYRI-------
A0A1E7KR89/124-217          PPVLERAGIRLDPNRREVFRNGSEIQLAPKEFAVLEVLMRGEGTVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVILTVPGAGYRI-------
A0A101NS44/124-217          PPVLERAGIKLDPNRREVFREGKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1R0LCU2/124-217          PPVLERAGIKLDPNRREVFREGKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
V6KZM2/124-217              PPVLERAGIKLDPNRREVFREGKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A197SI20/125-217          -PILERAGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A101S2X0/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A3N4U8D5/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A285CAB8/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0X3UWZ1/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A101UVI7/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2U2ZRS4/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1V4E1W5/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A429HNA5/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A429B8D6/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1H4ZKU8/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A401M9Y9/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
B5I2G9/125-217              -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A117Q9W5/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A3S9I968/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A3R8RXG0/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A101U3I2/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A3Q9ESB5/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0L8LI49/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2Z4IWI9/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
K4R1G7/125-217              -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1H0P2U8/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2A2Z1J0/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1A9BVI4/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1B1MIR2/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2G5INC6/125-217          -PVLERAGIKLDPNRREVFRDGQEVQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2L2MHH8/125-217          -PVLERAGIKLDPNRREVFRDGQEVQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2M9K1X9/124-217          PPVLERAGIKLDPNRREVLRDGKEIQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI-------
A0A370BJW3/124-217          PPVLERSGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2S9Q2U0/125-217          -PVLERAGIRLDPNRREVTRDGREIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0M2GVZ8/125-217          -PVLERAGIKLDPNRREVFRDGQEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A160P4J4/125-217          -PVLERAGIRLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1V9WP04/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0T1T214/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1V6MVH4/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A3G2J9L1/124-217          PPVLERAGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2R4JER2/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A428ZVG7/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A3S9ZAQ9/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A3M0I236/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1X4HUM9/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A255PFB2/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0Q9AUW2/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A3D9W8D2/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0N0HSF4/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0H4C6E4/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1C5BJ02/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A081XW39/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A3R8WW40/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0U5LX16/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A3Q8VA84/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
H1Q6P9/125-217              -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2N3TZF1/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A286FGB9/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A209CLN4/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
S5VAZ8/125-217              -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A089XGF6/125-217          -PVLERAGIKLDPNRREVFRDGREVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2G7F7F2/147-239          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
B5GUQ3/124-217              PPVLERAGIKLDPNRREIFRDGREIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A177I0J5/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
D9XSI8/125-217              -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A494V8B2/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A124C4B8/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1D8SVT8/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2P8PW09/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
L7EYG7/125-217              -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1Q4V688/124-217          PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIITVPGSGYRI-------
A0A1C6PWJ4/124-217          PPVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIITVPGSGYRI-------
A0A0M8TT16/143-235          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A327WN50/124-217          PPVLERAGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLLRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPAVIVTVPGSGYRI-------
A0A345HVI9/124-217          PPVLERSGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
G2GJS6/125-217              -PVLERAGIKLDPNRREVFRDGREVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2M8MCT0/125-217          -PVLERAGIRLDPGRREVFRDGRQVQLAPKEFAVLEVLMRSEGRVVSAEQLLEKAWDENADPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRV-------
A0A022MPP0/125-217          -PVLERAGIKLDPNRREVFRDGREVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1A9J249/125-217          -PVLERAGIKLDPNRREVFRDGREVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A231PJA3/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A209C4Z7/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A3N4SNK7/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2U9PA36/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A454W8Y0/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1S2PLK3/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0J8DEY6/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A3N1DT35/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2G6ZYQ7/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A270QUV4/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1M5WGZ6/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2S1IK59/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A3E0GPQ7/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1H5IMT2/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A076M543/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A066Y8S6/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2Z5K904/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1H5DEX1/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0X3XPV6/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0N6ZHT0/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2N9B5C8/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2N3XIS0/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1B1ATW1/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0K2B0E1/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0K8PLA1/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A3N1HUE3/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A429NMW1/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1R1WG71/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A101Q202/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A397QCE1/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A269U2Y8/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1Q5L6B9/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2W6Q8L3/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A429FRI3/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2P8AHB7/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2S6XEE1/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2S4ZEV2/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A3N4V382/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1C4SU15/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A286CQA8/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1S2PYG0/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1H2D2U4/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0S2P7K2/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A346C7V1/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0U3QD64/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1J4NXS7/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
M3CXS2/125-217              -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A143C7J7/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A117PUZ9/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2N8TFS0/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A421PC53/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1H9MTR5/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1K2FW94/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2U2F004/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2T4NAD3/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A399CK67/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A086MWK0/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A176KV54/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A3Q8VRT6/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A221P4C7/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A243S0Q0/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1Q5C088/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1Q5MGW4/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1H5EDC4/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A124I585/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1Q5KES9/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A370W2R9/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A345TLS1/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A1X7GYU3/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A101SRF8/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A101R1M9/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A2S2GJC8/128-220          ----ELAGLRLDPFRREVYRGGRHVALTRKQFAVLEVLVAAEGGVVSAEALLRRAWDENADPFTNAVRITVSALRKRLGEPRIIATVPGVGYRIDVP----
H2K2C0/125-217              -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
V6KFA8/124-217              PPVLERSGIKLDPNRREVFRDGKEIQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0J7ZJH9/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
C9Z0H0/125-217              -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
D9WZ77/125-217              -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A0L8NEU3/125-217          -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
P0A4I2/125-217              -PVLERAGIKLDPNRREVFRDGKEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI-------
A0A3E0GID0/128-224          ----EIAGLRLDPFRREVYRGGRYVALTRKQFAVLEVLVAAEGGVVSAEELLERAWDENADPFTNAVRITVSALRKRLGEPGIIATVPGVGYRIDTAPVSE
A0A076MBM4/128-224          ----EIAGLRLDPFRREVYRGGRYVALTRKQFAVLEVLVAAEGGVVSAEELLERAWDENADPFTNAVRITVSALRKRLGEPGIIATVPGVGYRIDTAPVSE
A0A1H2BPT7/128-224          ----EIAGLRLDPFRREVYRGGRYVALTRKQFAVLEVLVAAEGGVVSAEELLERAWDENADPFTNAVRITVSALRKRLGEPGIIATVPGVGYRIDTAPVSE
A0A397QMW9/128-224          ----EIAGLRLDPFRREVYRGGRYVALTRKQFAVLEVLVAAEGGVVSAEELLERAWDENADPFTNAVRITVSALRKRLGEPGIIATVPGVGYRIDTAPVSE
A0A0G3ASV0/128-223          ----EIAGLRLDPFRREVYRDGRYVALTRKQFAVLEVLVAAEGGVVSAEELLERAWDANADPFTNAVRITVSALRKRLGEPWIIATVPGVGYRIEPEPGA-
#=GC scorecons              04449589669995999879686575966969999899666996999996998799989699999699799669977998957969999599980000000
#=GC scorecons_70           ____*_*******_*********_*_**_**********_*******************************_*********_**_****_****_______
#=GC scorecons_80           ____*_**__***_****_*_*__*_*__*_*******___**_*****_*********_*****_*****__********_**_****_****_______
#=GC scorecons_90           ____*_**__***_****_*_*____*__*_*******___**_*****_***_*****_*****_**_**__**__****__*_****_****_______
//