# STOCKHOLM 1.0
#=GF ID 1.10.10.10/FF/000101
#=GF DE DNA-binding response OmpR family regulator
#=GF AC 1.10.10.10/FF/000101
#=GF TP FunFam
#=GF DR CATH: v4.3
#=GF DR DOPS: 29.987
#=GS Q9FBR2/147-243      AC Q9FBR2
#=GS Q9FBR2/147-243      OS Streptomyces coelicolor A3(2)
#=GS Q9FBR2/147-243      DE Putative two-component system response regulator
#=GS Q9FBR2/147-243      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albidoflavus group; Streptomyces coelicolor; 
#=GS A0A0N0MMH6/148-244  AC A0A0N0MMH6
#=GS A0A0N0MMH6/148-244  OS Actinobacteria bacterium OK006
#=GS A0A0N0MMH6/148-244  DE Two component transcriptional regulator, winged helix family
#=GS A0A0N0MMH6/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Actinobacteria bacterium OK006; 
#=GS A0A2P7PHU0/148-244  AC A0A2P7PHU0
#=GS A0A2P7PHU0/148-244  OS Streptosporangium nondiastaticum
#=GS A0A2P7PHU0/148-244  DE DNA-binding response regulator
#=GS A0A2P7PHU0/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptosporangiales; Streptosporangiaceae; Streptosporangium; Streptosporangium nondiastaticum; 
#=GS A0A0N1G762/148-244  AC A0A0N1G762
#=GS A0A0N1G762/148-244  OS Actinobacteria bacterium OK074
#=GS A0A0N1G762/148-244  DE Two component transcriptional regulator, winged helix family
#=GS A0A0N1G762/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Actinobacteria bacterium OK074; 
#=GS A0A0N1HDI0/149-245  AC A0A0N1HDI0
#=GS A0A0N1HDI0/149-245  OS Actinobacteria bacterium OV320
#=GS A0A0N1HDI0/149-245  DE Two component transcriptional regulator, winged helix family
#=GS A0A0N1HDI0/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Actinobacteria bacterium OV320; 
#=GS A0A1V0VDB1/148-244  AC A0A1V0VDB1
#=GS A0A1V0VDB1/148-244  OS Kitasatospora albolonga
#=GS A0A1V0VDB1/148-244  DE DNA-binding response regulator
#=GS A0A1V0VDB1/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Kitasatospora; Kitasatospora albolonga; 
#=GS A0A150VUF3/148-244  AC A0A150VUF3
#=GS A0A150VUF3/148-244  OS Streptomyces sp. WAC04657
#=GS A0A150VUF3/148-244  DE Two-component system response regulator
#=GS A0A150VUF3/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC04657; 
#=GS A0A2T7JVI6/148-244  AC A0A2T7JVI6
#=GS A0A2T7JVI6/148-244  OS Streptomyces sp. CS081A
#=GS A0A2T7JVI6/148-244  DE DNA-binding response regulator
#=GS A0A2T7JVI6/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CS081A; 
#=GS A0A429Q2I7/148-244  AC A0A429Q2I7
#=GS A0A429Q2I7/148-244  OS Streptomyces sp. WAC08241
#=GS A0A429Q2I7/148-244  DE DNA-binding response regulator
#=GS A0A429Q2I7/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC08241; 
#=GS A0A2L2PUK3/148-244  AC A0A2L2PUK3
#=GS A0A2L2PUK3/148-244  OS Streptomyces sp. WAC00288
#=GS A0A2L2PUK3/148-244  DE DNA-binding response regulator
#=GS A0A2L2PUK3/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC00288; 
#=GS A0A2N8NR31/148-244  AC A0A2N8NR31
#=GS A0A2N8NR31/148-244  OS Streptomyces eurocidicus
#=GS A0A2N8NR31/148-244  DE Chemotaxis protein CheY
#=GS A0A2N8NR31/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces eurocidicus; 
#=GS A0A1Z2L0U8/148-244  AC A0A1Z2L0U8
#=GS A0A1Z2L0U8/148-244  OS Streptomyces albireticuli
#=GS A0A1Z2L0U8/148-244  DE Chemotaxis protein CheY
#=GS A0A1Z2L0U8/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albireticuli; 
#=GS A0A1Q5ILS8/148-244  AC A0A1Q5ILS8
#=GS A0A1Q5ILS8/148-244  OS Streptomyces sp. CB02115
#=GS A0A1Q5ILS8/148-244  DE Chemotaxis protein CheY
#=GS A0A1Q5ILS8/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB02115; 
#=GS A0A1B9EIQ0/148-244  AC A0A1B9EIQ0
#=GS A0A1B9EIQ0/148-244  OS Streptomyces sp. PTY087I2
#=GS A0A1B9EIQ0/148-244  DE Alkaline phosphatase synthesis transcriptional regulatory protein PhoP
#=GS A0A1B9EIQ0/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. PTY087I2; 
#=GS A0A0Q7HXB2/148-244  AC A0A0Q7HXB2
#=GS A0A0Q7HXB2/148-244  OS Streptomyces sp. Root1295
#=GS A0A0Q7HXB2/148-244  DE Two-component system response regulator
#=GS A0A0Q7HXB2/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Root1295; 
#=GS A0A1Q5AIE7/148-244  AC A0A1Q5AIE7
#=GS A0A1Q5AIE7/148-244  OS Streptomyces sp. CB00072
#=GS A0A1Q5AIE7/148-244  DE Chemotaxis protein CheY
#=GS A0A1Q5AIE7/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB00072; 
#=GS A0A1Q8U4Z9/148-244  AC A0A1Q8U4Z9
#=GS A0A1Q8U4Z9/148-244  OS Streptomyces sp. MNU77
#=GS A0A1Q8U4Z9/148-244  DE DNA-binding response regulator
#=GS A0A1Q8U4Z9/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. MNU77; 
#=GS A0A384HMK9/148-244  AC A0A384HMK9
#=GS A0A384HMK9/148-244  OS Streptomyces sp. AC1-42W
#=GS A0A384HMK9/148-244  DE DNA-binding response regulator
#=GS A0A384HMK9/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. AC1-42W; 
#=GS A0A1Q5ESM3/148-244  AC A0A1Q5ESM3
#=GS A0A1Q5ESM3/148-244  OS Streptomyces sp. TSRI0261
#=GS A0A1Q5ESM3/148-244  DE Chemotaxis protein CheY
#=GS A0A1Q5ESM3/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. TSRI0261; 
#=GS A0A1Q5CF08/148-244  AC A0A1Q5CF08
#=GS A0A1Q5CF08/148-244  OS Streptomyces sp. TSRI0395
#=GS A0A1Q5CF08/148-244  DE Chemotaxis protein CheY
#=GS A0A1Q5CF08/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. TSRI0395; 
#=GS A0A209D668/148-244  AC A0A209D668
#=GS A0A209D668/148-244  OS Streptomyces sp. CS057
#=GS A0A209D668/148-244  DE DNA-binding response regulator
#=GS A0A209D668/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CS057; 
#=GS A0A0Q8E4P7/148-244  AC A0A0Q8E4P7
#=GS A0A0Q8E4P7/148-244  OS Streptomyces sp. Root63
#=GS A0A0Q8E4P7/148-244  DE Two-component system response regulator
#=GS A0A0Q8E4P7/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Root63; 
#=GS A0A1E5P667/148-243  AC A0A1E5P667
#=GS A0A1E5P667/148-243  OS Streptomyces agglomeratus
#=GS A0A1E5P667/148-243  DE DNA-binding response regulator
#=GS A0A1E5P667/148-243  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces agglomeratus; 
#=GS A0A367ENE4/152-248  AC A0A367ENE4
#=GS A0A367ENE4/152-248  OS Candidatus Streptomyces philanthi
#=GS A0A367ENE4/152-248  DE DNA-binding response regulator
#=GS A0A367ENE4/152-248  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Candidatus Streptomyces philanthi; 
#=GS A0A2U9P7G9/148-244  AC A0A2U9P7G9
#=GS A0A2U9P7G9/148-244  OS Streptomyces actuosus
#=GS A0A2U9P7G9/148-244  DE DNA-binding response regulator
#=GS A0A2U9P7G9/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces actuosus; 
#=GS A0A344TWE4/149-246  AC A0A344TWE4
#=GS A0A344TWE4/149-246  OS Streptomyces globosus
#=GS A0A344TWE4/149-246  DE DNA-binding response regulator
#=GS A0A344TWE4/149-246  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces globosus; 
#=GS A0A399CP48/149-245  AC A0A399CP48
#=GS A0A399CP48/149-245  OS Streptomyces sp. SHP22-7
#=GS A0A399CP48/149-245  DE DNA-binding response regulator
#=GS A0A399CP48/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. SHP22-7; 
#=GS A0A454W6V0/149-245  AC A0A454W6V0
#=GS A0A454W6V0/149-245  OS Streptomyces sp. WAC02707
#=GS A0A454W6V0/149-245  DE DNA-binding response regulator
#=GS A0A454W6V0/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC02707; 
#=GS A0A429NX23/149-245  AC A0A429NX23
#=GS A0A429NX23/149-245  OS Streptomyces sp. WAC08401
#=GS A0A429NX23/149-245  DE DNA-binding response regulator
#=GS A0A429NX23/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC08401; 
#=GS A0A2T7T7V5/148-244  AC A0A2T7T7V5
#=GS A0A2T7T7V5/148-244  OS Streptomyces scopuliridis RB72
#=GS A0A2T7T7V5/148-244  DE Chemotaxis protein CheY
#=GS A0A2T7T7V5/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces scopuliridis; 
#=GS A0A371Q8M3/149-244  AC A0A371Q8M3
#=GS A0A371Q8M3/149-244  OS Streptomyces sp. NEAU-D10
#=GS A0A371Q8M3/149-244  DE DNA-binding response regulator
#=GS A0A371Q8M3/149-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NEAU-D10; 
#=GS A0A2U2ZEV8/149-245  AC A0A2U2ZEV8
#=GS A0A2U2ZEV8/149-245  OS Streptomyces sp. NWU339
#=GS A0A2U2ZEV8/149-245  DE DNA-binding response regulator
#=GS A0A2U2ZEV8/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NWU339; 
#=GS A0A2L2MIX4/148-244  AC A0A2L2MIX4
#=GS A0A2L2MIX4/148-244  OS Streptomyces dengpaensis
#=GS A0A2L2MIX4/148-244  DE DNA-binding response regulator
#=GS A0A2L2MIX4/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces dengpaensis; 
#=GS A0A2G5J0W2/148-244  AC A0A2G5J0W2
#=GS A0A2G5J0W2/148-244  OS Streptomyces sp. HG99
#=GS A0A2G5J0W2/148-244  DE DNA-binding response regulator
#=GS A0A2G5J0W2/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. HG99; 
#=GS B5H4B5/148-244      AC B5H4B5
#=GS B5H4B5/148-244      OS Streptomyces clavuligerus ATCC 27064
#=GS B5H4B5/148-244      DE Two-component system response regulator
#=GS B5H4B5/148-244      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces clavuligerus; 
#=GS A0A429AHQ6/149-245  AC A0A429AHQ6
#=GS A0A429AHQ6/149-245  OS Streptomyces sp. WAC 01420
#=GS A0A429AHQ6/149-245  DE DNA-binding response regulator
#=GS A0A429AHQ6/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC 01420; 
#=GS A0A3S8WT18/149-245  AC A0A3S8WT18
#=GS A0A3S8WT18/149-245  OS Streptomyces sp. WAC 01438
#=GS A0A3S8WT18/149-245  DE DNA-binding response regulator
#=GS A0A3S8WT18/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC 01438; 
#=GS A0A429HEX8/148-244  AC A0A429HEX8
#=GS A0A429HEX8/148-244  OS Streptomyces sp. WAC 05379
#=GS A0A429HEX8/148-244  DE DNA-binding response regulator
#=GS A0A429HEX8/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC 05379; 
#=GS A0A428ZSX5/148-244  AC A0A428ZSX5
#=GS A0A428ZSX5/148-244  OS Streptomyces sp. WAC 01325
#=GS A0A428ZSX5/148-244  DE DNA-binding response regulator
#=GS A0A428ZSX5/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC 01325; 
#=GS A0A3Q9EX13/148-244  AC A0A3Q9EX13
#=GS A0A3Q9EX13/148-244  OS Streptomyces sp. MK-45
#=GS A0A3Q9EX13/148-244  DE Response regulator transcription factor
#=GS A0A3Q9EX13/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. MK-45; 
#=GS A0A2S1IIC9/148-244  AC A0A2S1IIC9
#=GS A0A2S1IIC9/148-244  OS Streptomyces nigra
#=GS A0A2S1IIC9/148-244  DE DNA-binding response regulator
#=GS A0A2S1IIC9/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces nigra; 
#=GS A0A0X3XJF7/148-244  AC A0A0X3XJF7
#=GS A0A0X3XJF7/148-244  OS Streptomyces sp. NRRL WC-3605
#=GS A0A0X3XJF7/148-244  DE Two-component system response regulator
#=GS A0A0X3XJF7/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL WC-3605; 
#=GS A0A1H4YGK4/148-244  AC A0A1H4YGK4
#=GS A0A1H4YGK4/148-244  OS Streptomyces sp. PAN_FS17
#=GS A0A1H4YGK4/148-244  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1H4YGK4/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. PAN_FS17; 
#=GS A0A370VRW7/148-244  AC A0A370VRW7
#=GS A0A370VRW7/148-244  OS Streptomyces sp. M7
#=GS A0A370VRW7/148-244  DE DNA-binding response regulator
#=GS A0A370VRW7/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. M7; 
#=GS A0A1D7VTG9/148-244  AC A0A1D7VTG9
#=GS A0A1D7VTG9/148-244  OS Streptomyces lydicus
#=GS A0A1D7VTG9/148-244  DE DNA-binding response regulator
#=GS A0A1D7VTG9/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces lydicus; 
#=GS A0A0A0NKZ1/149-245  AC A0A0A0NKZ1
#=GS A0A0A0NKZ1/149-245  OS Streptomyces rapamycinicus NRRL 5491
#=GS A0A0A0NKZ1/149-245  DE DNA-binding response regulator
#=GS A0A0A0NKZ1/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces rapamycinicus; 
#=GS A0A060ZTC4/149-245  AC A0A060ZTC4
#=GS A0A060ZTC4/149-245  OS Streptomyces iranensis
#=GS A0A060ZTC4/149-245  DE Two component transcriptional regulator, wingedhelix family
#=GS A0A060ZTC4/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces iranensis; 
#=GS A0A291SXC8/149-245  AC A0A291SXC8
#=GS A0A291SXC8/149-245  OS Streptomyces malaysiensis
#=GS A0A291SXC8/149-245  DE Alkaline phosphatase synthesis transcriptional regulatory protein PhoP
#=GS A0A291SXC8/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces malaysiensis; 
#=GS A0A222T210/149-245  AC A0A222T210
#=GS A0A222T210/149-245  OS Streptomyces sp. 11-1-2
#=GS A0A222T210/149-245  DE DNA-binding response regulator
#=GS A0A222T210/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 11-1-2; 
#=GS A0A1P8Y0Q3/149-245  AC A0A1P8Y0Q3
#=GS A0A1P8Y0Q3/149-245  OS Streptomyces autolyticus
#=GS A0A1P8Y0Q3/149-245  DE DNA-binding response regulator
#=GS A0A1P8Y0Q3/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces autolyticus; 
#=GS A0A2K8R452/149-245  AC A0A2K8R452
#=GS A0A2K8R452/149-245  OS Streptomyces sp. M56
#=GS A0A2K8R452/149-245  DE Alkaline phosphatase synthesis transcriptional regulatory protein PhoP
#=GS A0A2K8R452/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. M56; 
#=GS A0A1C5FDJ4/149-245  AC A0A1C5FDJ4
#=GS A0A1C5FDJ4/149-245  OS Streptomyces sp. MnatMP-M27
#=GS A0A1C5FDJ4/149-245  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C5FDJ4/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. MnatMP-M27; 
#=GS G2P239/149-245      AC G2P239
#=GS G2P239/149-245      OS Streptomyces violaceusniger Tu 4113
#=GS G2P239/149-245      DE Two component transcriptional regulator, winged helix family
#=GS G2P239/149-245      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces violaceusniger; 
#=GS A0A1S6RR26/149-245  AC A0A1S6RR26
#=GS A0A1S6RR26/149-245  OS Streptomyces hygroscopicus
#=GS A0A1S6RR26/149-245  DE Chemotaxis protein CheY
#=GS A0A1S6RR26/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces hygroscopicus; 
#=GS A0A014N2Q6/149-245  AC A0A014N2Q6
#=GS A0A014N2Q6/149-245  OS Streptomyces sp. PRh5
#=GS A0A014N2Q6/149-245  DE Chemotaxis protein CheY
#=GS A0A014N2Q6/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. PRh5; 
#=GS A0A2Z4UZH1/149-246  AC A0A2Z4UZH1
#=GS A0A2Z4UZH1/149-246  OS Streptomyces sp. ICC1
#=GS A0A2Z4UZH1/149-246  DE DNA-binding response regulator
#=GS A0A2Z4UZH1/149-246  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. ICC1; 
#=GS A0A089XH55/168-264  AC A0A089XH55
#=GS A0A089XH55/168-264  OS Streptomyces glaucescens
#=GS A0A089XH55/168-264  DE Transcriptional regulatory protein CseB
#=GS A0A089XH55/168-264  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces glaucescens; 
#=GS A0A2S4Z384/148-244  AC A0A2S4Z384
#=GS A0A2S4Z384/148-244  OS Streptomyces sp. Ru71
#=GS A0A2S4Z384/148-244  DE DNA-binding response regulator
#=GS A0A2S4Z384/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ru71; 
#=GS A0A221P426/149-245  AC A0A221P426
#=GS A0A221P426/149-245  OS Streptomyces pluripotens
#=GS A0A221P426/149-245  DE DNA-binding response regulator
#=GS A0A221P426/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces pluripotens; 
#=GS A0A0M2GFY8/149-245  AC A0A0M2GFY8
#=GS A0A0M2GFY8/149-245  OS Streptomyces variegatus
#=GS A0A0M2GFY8/149-245  DE Chemotaxis protein CheY
#=GS A0A0M2GFY8/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces variegatus; 
#=GS A0A286CNB0/149-245  AC A0A286CNB0
#=GS A0A286CNB0/149-245  OS Streptomyces sp. Ag82_G6-1
#=GS A0A286CNB0/149-245  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A286CNB0/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ag82_G6-1; 
#=GS A0A0N0TG99/149-245  AC A0A0N0TG99
#=GS A0A0N0TG99/149-245  OS Streptomyces sp. NRRL B-1140
#=GS A0A0N0TG99/149-245  DE Chemotaxis protein CheY
#=GS A0A0N0TG99/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL B-1140; 
#=GS A0A2T4NLC3/149-245  AC A0A2T4NLC3
#=GS A0A2T4NLC3/149-245  OS Streptomyces sp. A244
#=GS A0A2T4NLC3/149-245  DE DNA-binding response regulator
#=GS A0A2T4NLC3/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. A244; 
#=GS A0A143C5Y8/149-245  AC A0A143C5Y8
#=GS A0A143C5Y8/149-245  OS Streptomyces qaidamensis
#=GS A0A143C5Y8/149-245  DE DNA-binding response regulator
#=GS A0A143C5Y8/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces qaidamensis; 
#=GS A0A2S6WF79/149-245  AC A0A2S6WF79
#=GS A0A2S6WF79/149-245  OS Streptomyces sp. 46
#=GS A0A2S6WF79/149-245  DE DNA-binding response regulator
#=GS A0A2S6WF79/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 46; 
#=GS A0A2N8TJ27/149-245  AC A0A2N8TJ27
#=GS A0A2N8TJ27/149-245  OS Streptomyces sp. 13K301
#=GS A0A2N8TJ27/149-245  DE DNA-binding response regulator
#=GS A0A2N8TJ27/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 13K301; 
#=GS A0A1H5K360/149-245  AC A0A1H5K360
#=GS A0A1H5K360/149-245  OS Streptomyces sp. Ag109_O5-10
#=GS A0A1H5K360/149-245  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1H5K360/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ag109_O5-10; 
#=GS A0A2D3UK79/148-244  AC A0A2D3UK79
#=GS A0A2D3UK79/148-244  OS Streptomyces peucetius subsp. caesius ATCC 27952
#=GS A0A2D3UK79/148-244  DE DNA-binding response regulator
#=GS A0A2D3UK79/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces peucetius; Streptomyces peucetius subsp. caesius; 
#=GS A0A0C2BF06/148-244  AC A0A0C2BF06
#=GS A0A0C2BF06/148-244  OS Streptomyces sp. 150FB
#=GS A0A0C2BF06/148-244  DE Chemotaxis protein CheY
#=GS A0A0C2BF06/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 150FB; 
#=GS A0A0M8TNT2/148-245  AC A0A0M8TNT2
#=GS A0A0M8TNT2/148-245  OS Streptomyces sp. WM4235
#=GS A0A0M8TNT2/148-245  DE Chemotaxis protein CheY
#=GS A0A0M8TNT2/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WM4235; 
#=GS A0A2W2L7D3/148-244  AC A0A2W2L7D3
#=GS A0A2W2L7D3/148-244  OS Streptomyces sp. NTH33
#=GS A0A2W2L7D3/148-244  DE DNA-binding response regulator
#=GS A0A2W2L7D3/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NTH33; 
#=GS A0A0M8YLK9/148-244  AC A0A0M8YLK9
#=GS A0A0M8YLK9/148-244  OS Streptomyces sp. NRRL F-6491
#=GS A0A0M8YLK9/148-244  DE Chemotaxis protein CheY
#=GS A0A0M8YLK9/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL F-6491; 
#=GS A0A1Q5LWY6/148-244  AC A0A1Q5LWY6
#=GS A0A1Q5LWY6/148-244  OS Streptomyces sp. CB03234
#=GS A0A1Q5LWY6/148-244  DE Chemotaxis protein CheY
#=GS A0A1Q5LWY6/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB03234; 
#=GS A0A1K2FXW1/150-246  AC A0A1K2FXW1
#=GS A0A1K2FXW1/150-246  OS Streptomyces sp. F-1
#=GS A0A1K2FXW1/150-246  DE Alkaline phosphatase synthesis transcriptional regulatory protein PhoP
#=GS A0A1K2FXW1/150-246  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. F-1; 
#=GS A0A1H5BX44/150-246  AC A0A1H5BX44
#=GS A0A1H5BX44/150-246  OS Streptomyces misionensis
#=GS A0A1H5BX44/150-246  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1H5BX44/150-246  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces misionensis; 
#=GS A0A3Q9C490/149-245  AC A0A3Q9C490
#=GS A0A3Q9C490/149-245  OS Streptomyces sp. GGCR-6
#=GS A0A3Q9C490/149-245  DE Response regulator transcription factor
#=GS A0A3Q9C490/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. GGCR-6; 
#=GS M3D9L3/149-245      AC M3D9L3
#=GS M3D9L3/149-245      OS Streptomyces gancidicus BKS 13-15
#=GS M3D9L3/149-245      DE Two-component system response regulator
#=GS M3D9L3/149-245      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces gancidicus; 
#=GS A0A2U3C4W6/152-247  AC A0A2U3C4W6
#=GS A0A2U3C4W6/152-247  OS Streptomyces sp. ICBB 8177
#=GS A0A2U3C4W6/152-247  DE DNA-binding response regulator
#=GS A0A2U3C4W6/152-247  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. ICBB 8177; 
#=GS A0A0A8EJJ4/154-249  AC A0A0A8EJJ4
#=GS A0A0A8EJJ4/154-249  OS Streptomyces sp. 769
#=GS A0A0A8EJJ4/154-249  DE Two component transcriptional regulator C winged helix family
#=GS A0A0A8EJJ4/154-249  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 769; 
#=GS A0A1J4Q3F1/150-246  AC A0A1J4Q3F1
#=GS A0A1J4Q3F1/150-246  OS Streptomyces malaysiense
#=GS A0A1J4Q3F1/150-246  DE DNA-binding response regulator
#=GS A0A1J4Q3F1/150-246  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces malaysiense; 
#=GS A0A494V6D4/149-245  AC A0A494V6D4
#=GS A0A494V6D4/149-245  OS Streptomyces fungicidicus
#=GS A0A494V6D4/149-245  DE DNA-binding response regulator
#=GS A0A494V6D4/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces fungicidicus; 
#=GS D9XM91/149-245      AC D9XM91
#=GS D9XM91/149-245      OS Streptomyces griseoflavus Tu4000
#=GS D9XM91/149-245      DE Transcriptional regulatory protein CseB
#=GS D9XM91/149-245      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseoflavus; 
#=GS A0A291QG50/149-245  AC A0A291QG50
#=GS A0A291QG50/149-245  OS Streptomyces formicae
#=GS A0A291QG50/149-245  DE Putative two-component system response regulator
#=GS A0A291QG50/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces formicae; 
#=GS F2R2X9/148-244      AC F2R2X9
#=GS F2R2X9/148-244      OS Streptomyces venezuelae ATCC 10712
#=GS F2R2X9/148-244      DE Putative two-component system response regulator
#=GS F2R2X9/148-244      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces venezuelae; 
#=GS F8JPD5/152-247      AC F8JPD5
#=GS F8JPD5/152-247      OS Streptomyces cattleya NRRL 8057 = DSM 46488
#=GS F8JPD5/152-247      DE Two-component system response regulator
#=GS F8JPD5/152-247      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces cattleya; 
#=GS A0A2N0IYZ2/149-245  AC A0A2N0IYZ2
#=GS A0A2N0IYZ2/149-245  OS Streptomyces sp. 69
#=GS A0A2N0IYZ2/149-245  DE DNA-binding response OmpR family regulator
#=GS A0A2N0IYZ2/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 69; 
#=GS A0A1C4M2G9/170-266  AC A0A1C4M2G9
#=GS A0A1C4M2G9/170-266  OS Streptomyces sp. TverLS-915
#=GS A0A1C4M2G9/170-266  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C4M2G9/170-266  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. TverLS-915; 
#=GS D9UU16/170-266      AC D9UU16
#=GS D9UU16/170-266      OS Streptomyces sp. SPB78
#=GS D9UU16/170-266      DE Phosphate regulon transcriptional regulatory protein PhoB
#=GS D9UU16/170-266      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. SPB78; 
#=GS A0A0T1QB90/148-244  AC A0A0T1QB90
#=GS A0A0T1QB90/148-244  OS Streptomyces sp. Root431
#=GS A0A0T1QB90/148-244  DE Two-component system response regulator
#=GS A0A0T1QB90/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Root431; 
#=GS A0A3R9WVT4/148-244  AC A0A3R9WVT4
#=GS A0A3R9WVT4/148-244  OS Streptomyces sp. WAC01280
#=GS A0A3R9WVT4/148-244  DE DNA-binding response regulator
#=GS A0A3R9WVT4/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC01280; 
#=GS A0A1R1SPG8/149-245  AC A0A1R1SPG8
#=GS A0A1R1SPG8/149-245  OS Streptomyces sparsogenes DSM 40356
#=GS A0A1R1SPG8/149-245  DE Winged helix family two component transcriptional regulator
#=GS A0A1R1SPG8/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sparsogenes; 
#=GS F3NN15/148-244      AC F3NN15
#=GS F3NN15/148-244      OS Streptomyces griseoaurantiacus M045
#=GS F3NN15/148-244      DE Two-component system response regulator
#=GS F3NN15/148-244      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseoaurantiacus; 
#=GS A0A1G7GDA3/148-244  AC A0A1G7GDA3
#=GS A0A1G7GDA3/148-244  OS Streptomyces jietaisiensis
#=GS A0A1G7GDA3/148-244  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1G7GDA3/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces jietaisiensis; 
#=GS A0A0C5FUN5/149-245  AC A0A0C5FUN5
#=GS A0A0C5FUN5/149-245  OS Streptomyces cyaneogriseus subsp. noncyanogenus
#=GS A0A0C5FUN5/149-245  DE Chemotaxis protein CheY
#=GS A0A0C5FUN5/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces cyaneogriseus; Streptomyces cyaneogriseus subsp. noncyanogenus; 
#=GS A0A3G2JDL2/149-245  AC A0A3G2JDL2
#=GS A0A3G2JDL2/149-245  OS Streptomyces sp. Z022
#=GS A0A3G2JDL2/149-245  DE DNA-binding response regulator
#=GS A0A3G2JDL2/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Z022; 
#=GS A0A2M9IMU3/148-244  AC A0A2M9IMU3
#=GS A0A2M9IMU3/148-244  OS Streptomyces sp. CB01373
#=GS A0A2M9IMU3/148-244  DE DNA-binding response regulator
#=GS A0A2M9IMU3/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB01373; 
#=GS A0A1H5J675/149-245  AC A0A1H5J675
#=GS A0A1H5J675/149-245  OS Streptomyces sp. 3213.3
#=GS A0A1H5J675/149-245  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1H5J675/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 3213.3; 
#=GS A0A2I0SKS3/148-244  AC A0A2I0SKS3
#=GS A0A2I0SKS3/148-244  OS Streptomyces populi
#=GS A0A2I0SKS3/148-244  DE DNA-binding response regulator
#=GS A0A2I0SKS3/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces populi; 
#=GS A0A2R4T7Z6/148-244  AC A0A2R4T7Z6
#=GS A0A2R4T7Z6/148-244  OS Streptomyces lunaelactis
#=GS A0A2R4T7Z6/148-244  DE DNA-binding response regulator
#=GS A0A2R4T7Z6/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces lunaelactis; 
#=GS A0A0T6LS81/148-244  AC A0A0T6LS81
#=GS A0A0T6LS81/148-244  OS Streptomyces vitaminophilus
#=GS A0A0T6LS81/148-244  DE Two-component system response regulator
#=GS A0A0T6LS81/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces vitaminophilus; 
#=GS A0A353KI61/148-244  AC A0A353KI61
#=GS A0A353KI61/148-244  OS Streptomyces sp.
#=GS A0A353KI61/148-244  DE DNA-binding response regulator
#=GS A0A353KI61/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp.; 
#=GS G2NM64/148-244      AC G2NM64
#=GS G2NM64/148-244      OS Streptomyces sp. SirexAA-E
#=GS G2NM64/148-244      DE Two component transcriptional regulator, winged helix family
#=GS G2NM64/148-244      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. SirexAA-E; 
#=GS A0A327T4D1/148-244  AC A0A327T4D1
#=GS A0A327T4D1/148-244  OS Streptomyces sp. DpondAA-E10
#=GS A0A327T4D1/148-244  DE DNA-binding response OmpR family regulator
#=GS A0A327T4D1/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. DpondAA-E10; 
#=GS A0A437PDJ8/148-244  AC A0A437PDJ8
#=GS A0A437PDJ8/148-244  OS Streptomyces sp. San01
#=GS A0A437PDJ8/148-244  DE Response regulator transcription factor
#=GS A0A437PDJ8/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. San01; 
#=GS A0A371XT27/148-244  AC A0A371XT27
#=GS A0A371XT27/148-244  OS Streptomyces sp. AcE210
#=GS A0A371XT27/148-244  DE DNA-binding response regulator
#=GS A0A371XT27/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. AcE210; 
#=GS D6K0L2/148-244      AC D6K0L2
#=GS D6K0L2/148-244      OS Streptomyces sp. e14
#=GS D6K0L2/148-244      DE Transcriptional regulatory protein CseB
#=GS D6K0L2/148-244      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. e14; 
#=GS A0A3Q9FWL6/148-244  AC A0A3Q9FWL6
#=GS A0A3Q9FWL6/148-244  OS Streptomyces luteoverticillatus
#=GS A0A3Q9FWL6/148-244  DE Response regulator transcription factor
#=GS A0A3Q9FWL6/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces luteoverticillatus; 
#=GS A0A1E5PVU6/148-245  AC A0A1E5PVU6
#=GS A0A1E5PVU6/148-245  OS Streptomyces subrutilus
#=GS A0A1E5PVU6/148-245  DE DNA-binding response regulator
#=GS A0A1E5PVU6/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces subrutilus; 
#=GS A0A2G1XDE3/148-244  AC A0A2G1XDE3
#=GS A0A2G1XDE3/148-244  OS Streptomyces cinnamoneus
#=GS A0A2G1XDE3/148-244  DE DNA-binding response regulator
#=GS A0A2G1XDE3/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces cinnamoneus group; Streptomyces cinnamoneus; 
#=GS A0A3M8TXX9/149-245  AC A0A3M8TXX9
#=GS A0A3M8TXX9/149-245  OS Streptomyces sp. NEAU-LD23
#=GS A0A3M8TXX9/149-245  DE DNA-binding response regulator
#=GS A0A3M8TXX9/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NEAU-LD23; 
#=GS D9WG74/149-245      AC D9WG74
#=GS D9WG74/149-245      OS Streptomyces himastatinicus ATCC 53653
#=GS D9WG74/149-245      DE Transcriptional regulatory protein CseB
#=GS D9WG74/149-245      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces himastatinicus; 
#=GS A0A0N0A3Z6/148-244  AC A0A0N0A3Z6
#=GS A0A0N0A3Z6/148-244  OS Streptomyces sp. NRRL WC-3618
#=GS A0A0N0A3Z6/148-244  DE Chemotaxis protein CheY
#=GS A0A0N0A3Z6/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL WC-3618; 
#=GS A0A1D8SUH3/149-245  AC A0A1D8SUH3
#=GS A0A1D8SUH3/149-245  OS Streptomyces olivaceus
#=GS A0A1D8SUH3/149-245  DE DNA-binding response regulator
#=GS A0A1D8SUH3/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces olivaceus; 
#=GS A0A429SG76/149-246  AC A0A429SG76
#=GS A0A429SG76/149-246  OS Streptomyces sp. WAC05292
#=GS A0A429SG76/149-246  DE DNA-binding response regulator
#=GS A0A429SG76/149-246  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC05292; 
#=GS A0A1V0TWN1/149-245  AC A0A1V0TWN1
#=GS A0A1V0TWN1/149-245  OS Streptomyces gilvosporeus
#=GS A0A1V0TWN1/149-245  DE DNA-binding response regulator
#=GS A0A1V0TWN1/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces gilvosporeus; 
#=GS A0A0D7CFD2/149-245  AC A0A0D7CFD2
#=GS A0A0D7CFD2/149-245  OS Streptomyces natalensis ATCC 27448
#=GS A0A0D7CFD2/149-245  DE Chemotaxis protein CheY
#=GS A0A0D7CFD2/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces natalensis; 
#=GS A0A2G9DQG5/148-244  AC A0A2G9DQG5
#=GS A0A2G9DQG5/148-244  OS Streptomyces sp. JV178
#=GS A0A2G9DQG5/148-244  DE DNA-binding response regulator
#=GS A0A2G9DQG5/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. JV178; 
#=GS A0A3N1LQP6/148-244  AC A0A3N1LQP6
#=GS A0A3N1LQP6/148-244  OS Streptomyces ossamyceticus
#=GS A0A3N1LQP6/148-244  DE DNA-binding response OmpR family regulator
#=GS A0A3N1LQP6/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces ossamyceticus; 
#=GS A0A2P9FDJ3/148-244  AC A0A2P9FDJ3
#=GS A0A2P9FDJ3/148-244  OS Streptomyces sp. MA5143a
#=GS A0A2P9FDJ3/148-244  DE Alkaline phosphatase synthesis transcriptional regulatory protein PhoP
#=GS A0A2P9FDJ3/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. MA5143a; 
#=GS A0A100Y448/148-244  AC A0A100Y448
#=GS A0A100Y448/148-244  OS Streptomyces kanasensis
#=GS A0A100Y448/148-244  DE Two-component system response regulator
#=GS A0A100Y448/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces kanasensis; 
#=GS A0A0K9XET1/148-244  AC A0A0K9XET1
#=GS A0A0K9XET1/148-244  OS Streptomyces caatingaensis
#=GS A0A0K9XET1/148-244  DE Chemotaxis protein CheY
#=GS A0A0K9XET1/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces caatingaensis; 
#=GS A0A0W7WZW4/149-245  AC A0A0W7WZW4
#=GS A0A0W7WZW4/149-245  OS Streptomyces silvensis
#=GS A0A0W7WZW4/149-245  DE Two-component system response regulator
#=GS A0A0W7WZW4/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces silvensis; 
#=GS A0A2N0GTY3/148-245  AC A0A2N0GTY3
#=GS A0A2N0GTY3/148-245  OS Streptomyces sp. Ag109_G2-1
#=GS A0A2N0GTY3/148-245  DE DNA-binding response OmpR family regulator
#=GS A0A2N0GTY3/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ag109_G2-1; 
#=GS A0A3N5AKY1/148-245  AC A0A3N5AKY1
#=GS A0A3N5AKY1/148-245  OS Streptomyces sp. Ag109_G2-6
#=GS A0A3N5AKY1/148-245  DE DNA-binding response OmpR family regulator
#=GS A0A3N5AKY1/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ag109_G2-6; 
#=GS A0A0C1VKE5/147-244  AC A0A0C1VKE5
#=GS A0A0C1VKE5/147-244  OS Streptomyces sp. RSD-27
#=GS A0A0C1VKE5/147-244  DE Chemotaxis protein CheY
#=GS A0A0C1VKE5/147-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. RSD-27; 
#=GS A0A0M9Z8F3/148-245  AC A0A0M9Z8F3
#=GS A0A0M9Z8F3/148-245  OS Streptomyces sp. H036
#=GS A0A0M9Z8F3/148-245  DE Chemotaxis protein CheY
#=GS A0A0M9Z8F3/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. H036; 
#=GS A0A1L7GJP3/148-245  AC A0A1L7GJP3
#=GS A0A1L7GJP3/148-245  OS Streptomyces sp. TN58
#=GS A0A1L7GJP3/148-245  DE DNA-binding response regulator
#=GS A0A1L7GJP3/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. TN58; 
#=GS A0A0M8UKM7/148-245  AC A0A0M8UKM7
#=GS A0A0M8UKM7/148-245  OS Streptomyces sp. H021
#=GS A0A0M8UKM7/148-245  DE Chemotaxis protein CheY
#=GS A0A0M8UKM7/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. H021; 
#=GS A0A0F0GTZ5/148-245  AC A0A0F0GTZ5
#=GS A0A0F0GTZ5/148-245  OS Streptomyces sp. NRRL F-4428
#=GS A0A0F0GTZ5/148-245  DE Chemotaxis protein CheY
#=GS A0A0F0GTZ5/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL F-4428; 
#=GS A0A1U9P2G9/148-245  AC A0A1U9P2G9
#=GS A0A1U9P2G9/148-245  OS Streptomyces sp. fd1-xmd
#=GS A0A1U9P2G9/148-245  DE DNA-binding response regulator
#=GS A0A1U9P2G9/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. fd1-xmd; 
#=GS A0A3R9X4V5/148-245  AC A0A3R9X4V5
#=GS A0A3R9X4V5/148-245  OS Streptomyces sp. WAC05950
#=GS A0A3R9X4V5/148-245  DE DNA-binding response regulator
#=GS A0A3R9X4V5/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC05950; 
#=GS A0A0F4I512/148-245  AC A0A0F4I512
#=GS A0A0F4I512/148-245  OS Streptomyces sp. NRRL S-104
#=GS A0A0F4I512/148-245  DE Chemotaxis protein CheY
#=GS A0A0F4I512/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL S-104; 
#=GS A0A0G3AIW8/149-245  AC A0A0G3AIW8
#=GS A0A0G3AIW8/149-245  OS Streptomyces incarnatus
#=GS A0A0G3AIW8/149-245  DE Chemotaxis protein CheY
#=GS A0A0G3AIW8/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces incarnatus; 
#=GS A0A101P041/149-245  AC A0A101P041
#=GS A0A101P041/149-245  OS Streptomyces yokosukanensis
#=GS A0A101P041/149-245  DE Two-component system response regulator
#=GS A0A101P041/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces yokosukanensis; 
#=GS A0A101NIX9/149-245  AC A0A101NIX9
#=GS A0A101NIX9/149-245  OS Streptomyces cellostaticus
#=GS A0A101NIX9/149-245  DE Two-component system response regulator
#=GS A0A101NIX9/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces cellostaticus; 
#=GS A0A0N0AET6/149-245  AC A0A0N0AET6
#=GS A0A0N0AET6/149-245  OS Streptomyces sp. NRRL B-3648
#=GS A0A0N0AET6/149-245  DE Chemotaxis protein CheY
#=GS A0A0N0AET6/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL B-3648; 
#=GS A0A367H9L1/148-244  AC A0A367H9L1
#=GS A0A367H9L1/148-244  OS Streptomyces sp. SDr-06
#=GS A0A367H9L1/148-244  DE DNA-binding response regulator
#=GS A0A367H9L1/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. SDr-06; 
#=GS A0A0M8SGV7/148-244  AC A0A0M8SGV7
#=GS A0A0M8SGV7/148-244  OS Streptomyces sp. WM6378
#=GS A0A0M8SGV7/148-244  DE Chemotaxis protein CheY
#=GS A0A0M8SGV7/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WM6378; 
#=GS A0A2M9IUJ3/148-244  AC A0A2M9IUJ3
#=GS A0A2M9IUJ3/148-244  OS Streptomyces sp. CB01201
#=GS A0A2M9IUJ3/148-244  DE DNA-binding response regulator
#=GS A0A2M9IUJ3/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB01201; 
#=GS A0A1Q5E351/148-244  AC A0A1Q5E351
#=GS A0A1Q5E351/148-244  OS Streptomyces sp. CB01249
#=GS A0A1Q5E351/148-244  DE Chemotaxis protein CheY
#=GS A0A1Q5E351/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB01249; 
#=GS A0A3G4VYB6/148-245  AC A0A3G4VYB6
#=GS A0A3G4VYB6/148-245  OS Streptomyces sp. ADI95-16
#=GS A0A3G4VYB6/148-245  DE Alkaline phosphatase synthesis transcriptional regulatory protein PhoP
#=GS A0A3G4VYB6/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. ADI95-16; 
#=GS A0A2M9KAN1/148-245  AC A0A2M9KAN1
#=GS A0A2M9KAN1/148-245  OS Streptomyces sp. CB02120-2
#=GS A0A2M9KAN1/148-245  DE DNA-binding response regulator
#=GS A0A2M9KAN1/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB02120-2; 
#=GS A0A1Q5BDC5/148-245  AC A0A1Q5BDC5
#=GS A0A1Q5BDC5/148-245  OS Streptomyces sp. MJM1172
#=GS A0A1Q5BDC5/148-245  DE Chemotaxis protein CheY
#=GS A0A1Q5BDC5/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. MJM1172; 
#=GS B4VF41/148-245      AC B4VF41
#=GS B4VF41/148-245      OS Streptomyces sp. Mg1
#=GS B4VF41/148-245      DE Chemotaxis protein CheY
#=GS B4VF41/148-245      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Mg1; 
#=GS A0A1Q4Y4F8/148-245  AC A0A1Q4Y4F8
#=GS A0A1Q4Y4F8/148-245  OS Streptomyces sp. CB03578
#=GS A0A1Q4Y4F8/148-245  DE DNA-binding response regulator
#=GS A0A1Q4Y4F8/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB03578; 
#=GS A0A3N6DG31/148-245  AC A0A3N6DG31
#=GS A0A3N6DG31/148-245  OS Streptomyces sp. ADI91-18
#=GS A0A3N6DG31/148-245  DE Alkaline phosphatase synthesis transcriptional regulatory protein PhoP
#=GS A0A3N6DG31/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. ADI91-18; 
#=GS A0A1X7FLA1/149-245  AC A0A1X7FLA1
#=GS A0A1X7FLA1/149-245  OS Streptomyces sp. Amel2xC10
#=GS A0A1X7FLA1/149-245  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1X7FLA1/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Amel2xC10; 
#=GS L1KHY7/148-244      AC L1KHY7
#=GS L1KHY7/148-244      OS Streptomyces ipomoeae 91-03
#=GS L1KHY7/148-244      DE Response regulator receiver domain protein
#=GS L1KHY7/148-244      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces ipomoeae; 
#=GS V6KL06/149-245      AC V6KL06
#=GS V6KL06/149-245      OS Streptomyces roseochromogenus subsp. oscitans DS 12.976
#=GS V6KL06/149-245      DE Chemotaxis protein CheY
#=GS V6KL06/149-245      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces roseochromogenus; Streptomyces roseochromogenus subsp. oscitans; 
#=GS A0A2V2Q5E3/148-244  AC A0A2V2Q5E3
#=GS A0A2V2Q5E3/148-244  OS Streptomyces sp. FT05W
#=GS A0A2V2Q5E3/148-244  DE DNA-binding response regulator
#=GS A0A2V2Q5E3/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. FT05W; 
#=GS A0A1C6P2N2/148-244  AC A0A1C6P2N2
#=GS A0A1C6P2N2/148-244  OS Streptomyces sp. LamerLS-316
#=GS A0A1C6P2N2/148-244  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C6P2N2/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. LamerLS-316; 
#=GS A0A1Q5DQU6/148-244  AC A0A1Q5DQU6
#=GS A0A1Q5DQU6/148-244  OS Streptomyces sp. CB02058
#=GS A0A1Q5DQU6/148-244  DE Chemotaxis protein CheY
#=GS A0A1Q5DQU6/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB02058; 
#=GS A0A0N0YFR9/148-244  AC A0A0N0YFR9
#=GS A0A0N0YFR9/148-244  OS Streptomyces sp. NRRL S-4
#=GS A0A0N0YFR9/148-244  DE Chemotaxis protein CheY
#=GS A0A0N0YFR9/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL S-4; 
#=GS E8WCN7/148-244      AC E8WCN7
#=GS E8WCN7/148-244      OS Streptomyces pratensis ATCC 33331
#=GS E8WCN7/148-244      DE Two component transcriptional regulator, winged helix family
#=GS E8WCN7/148-244      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces pratensis; 
#=GS A0A1C5C202/148-244  AC A0A1C5C202
#=GS A0A1C5C202/148-244  OS Streptomyces sp. Ncost-T10-10d
#=GS A0A1C5C202/148-244  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C5C202/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ncost-T10-10d; 
#=GS A0A2S6PUD8/148-244  AC A0A2S6PUD8
#=GS A0A2S6PUD8/148-244  OS Streptomyces sp. QL37
#=GS A0A2S6PUD8/148-244  DE DNA-binding response regulator
#=GS A0A2S6PUD8/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. QL37; 
#=GS A0A3N1SL45/148-244  AC A0A3N1SL45
#=GS A0A3N1SL45/148-244  OS Streptomyces sp. 840.1
#=GS A0A3N1SL45/148-244  DE DNA-binding response OmpR family regulator
#=GS A0A3N1SL45/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 840.1; 
#=GS A0A329CAX1/148-244  AC A0A329CAX1
#=GS A0A329CAX1/148-244  OS Streptomyces avidinii
#=GS A0A329CAX1/148-244  DE DNA-binding response OmpR family regulator
#=GS A0A329CAX1/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces avidinii; 
#=GS A0A3N6EXC8/148-244  AC A0A3N6EXC8
#=GS A0A3N6EXC8/148-244  OS Streptomyces sp. ADI93-02
#=GS A0A3N6EXC8/148-244  DE Alkaline phosphatase synthesis transcriptional regulatory protein PhoP
#=GS A0A3N6EXC8/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. ADI93-02; 
#=GS A0A1Q5MNN8/148-244  AC A0A1Q5MNN8
#=GS A0A1Q5MNN8/148-244  OS Streptomyces sp. CB02488
#=GS A0A1Q5MNN8/148-244  DE Chemotaxis protein CheY
#=GS A0A1Q5MNN8/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB02488; 
#=GS A0A1C4SCN1/148-244  AC A0A1C4SCN1
#=GS A0A1C4SCN1/148-244  OS Streptomyces sp. DvalAA-43
#=GS A0A1C4SCN1/148-244  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C4SCN1/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. DvalAA-43; 
#=GS A0A285DBS4/148-244  AC A0A285DBS4
#=GS A0A285DBS4/148-244  OS Streptomyces microflavus
#=GS A0A285DBS4/148-244  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A285DBS4/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseus group; Streptomyces microflavus subgroup; Streptomyces microflavus; 
#=GS A0A0X3VWY8/149-245  AC A0A0X3VWY8
#=GS A0A0X3VWY8/149-245  OS Streptomyces sp. NRRL S-1521
#=GS A0A0X3VWY8/149-245  DE Two-component system response regulator
#=GS A0A0X3VWY8/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL S-1521; 
#=GS A0A3B7QI75/149-245  AC A0A3B7QI75
#=GS A0A3B7QI75/149-245  OS Streptomyces fradiae
#=GS A0A3B7QI75/149-245  DE DNA-binding response regulator
#=GS A0A3B7QI75/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces fradiae; 
#=GS A0A1P8TFI1/149-245  AC A0A1P8TFI1
#=GS A0A1P8TFI1/149-245  OS Streptomyces alfalfae
#=GS A0A1P8TFI1/149-245  DE DNA-binding response regulator
#=GS A0A1P8TFI1/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces alfalfae; 
#=GS A0A170W9M5/148-244  AC A0A170W9M5
#=GS A0A170W9M5/148-244  OS Streptomyces sp. F-3
#=GS A0A170W9M5/148-244  DE Chemotaxis protein CheY
#=GS A0A170W9M5/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. F-3; 
#=GS L7EQ27/148-244      AC L7EQ27
#=GS L7EQ27/148-244      OS Streptomyces turgidiscabies Car8
#=GS L7EQ27/148-244      DE Response regulator receiver domain protein
#=GS L7EQ27/148-244      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces turgidiscabies; 
#=GS B5HKJ3/160-256      AC B5HKJ3
#=GS B5HKJ3/160-256      OS Streptomyces pristinaespiralis ATCC 25486
#=GS B5HKJ3/160-256      DE Two-component system response regulator
#=GS B5HKJ3/160-256      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces pristinaespiralis; 
#=GS A0A0L0K2V7/149-245  AC A0A0L0K2V7
#=GS A0A0L0K2V7/149-245  OS Streptomyces acidiscabies
#=GS A0A0L0K2V7/149-245  DE Alkaline phosphatase synthesis transcriptional
#=GS A0A0L0K2V7/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces acidiscabies; 
#=GS A0A3Q9KUY9/148-244  AC A0A3Q9KUY9
#=GS A0A3Q9KUY9/148-244  OS Streptomyces griseoviridis
#=GS A0A3Q9KUY9/148-244  DE Response regulator transcription factor
#=GS A0A3Q9KUY9/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseoviridis; 
#=GS A0A1C4S172/148-244  AC A0A1C4S172
#=GS A0A1C4S172/148-244  OS Streptomyces sp. SolWspMP-5a-2
#=GS A0A1C4S172/148-244  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C4S172/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. SolWspMP-5a-2; 
#=GS A0A3S8WF18/149-245  AC A0A3S8WF18
#=GS A0A3S8WF18/149-245  OS Streptomyces sp. WAC 01529
#=GS A0A3S8WF18/149-245  DE DNA-binding response regulator
#=GS A0A3S8WF18/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC 01529; 
#=GS A0A1Q5KZE0/149-245  AC A0A1Q5KZE0
#=GS A0A1Q5KZE0/149-245  OS Streptomyces sp. CB01883
#=GS A0A1Q5KZE0/149-245  DE Chemotaxis protein CheY
#=GS A0A1Q5KZE0/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB01883; 
#=GS A0A3N1I928/149-245  AC A0A3N1I928
#=GS A0A3N1I928/149-245  OS Streptomyces sp. PanSC9
#=GS A0A3N1I928/149-245  DE DNA-binding response OmpR family regulator
#=GS A0A3N1I928/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. PanSC9; 
#=GS A0A2M9JPY9/148-244  AC A0A2M9JPY9
#=GS A0A2M9JPY9/148-244  OS Streptomyces sp. CB01635
#=GS A0A2M9JPY9/148-244  DE DNA-binding response regulator
#=GS A0A2M9JPY9/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB01635; 
#=GS A0A2Z2YID6/148-244  AC A0A2Z2YID6
#=GS A0A2Z2YID6/148-244  OS Streptomyces cavourensis
#=GS A0A2Z2YID6/148-244  DE DNA-binding response regulator
#=GS A0A2Z2YID6/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces cavourensis; 
#=GS A0A0M4E3H8/148-244  AC A0A0M4E3H8
#=GS A0A0M4E3H8/148-244  OS Streptomyces sp. CFMR 7
#=GS A0A0M4E3H8/148-244  DE Chemotaxis protein CheY
#=GS A0A0M4E3H8/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CFMR 7; 
#=GS A0A1W5YXX1/148-244  AC A0A1W5YXX1
#=GS A0A1W5YXX1/148-244  OS Streptomyces sp. S8
#=GS A0A1W5YXX1/148-244  DE DNA-binding response regulator
#=GS A0A1W5YXX1/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. S8; 
#=GS N0CYI7/148-244      AC N0CYI7
#=GS N0CYI7/148-244      OS Streptomyces fulvissimus DSM 40593
#=GS N0CYI7/148-244      DE Two component transcriptional regulator, winged helix family
#=GS N0CYI7/148-244      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces fulvissimus; 
#=GS A0A1C6LNC3/148-244  AC A0A1C6LNC3
#=GS A0A1C6LNC3/148-244  OS Streptomyces sp. ScaeMP-e48
#=GS A0A1C6LNC3/148-244  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C6LNC3/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. ScaeMP-e48; 
#=GS A0A2V2PSR2/148-244  AC A0A2V2PSR2
#=GS A0A2V2PSR2/148-244  OS Streptomyces sp. ZEA17I
#=GS A0A2V2PSR2/148-244  DE DNA-binding response regulator
#=GS A0A2V2PSR2/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. ZEA17I; 
#=GS A0A1C4MYD8/148-244  AC A0A1C4MYD8
#=GS A0A1C4MYD8/148-244  OS Streptomyces sp. DvalAA-19
#=GS A0A1C4MYD8/148-244  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C4MYD8/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. DvalAA-19; 
#=GS A0A1E7LU07/148-244  AC A0A1E7LU07
#=GS A0A1E7LU07/148-244  OS Streptomyces nanshensis
#=GS A0A1E7LU07/148-244  DE Chemotaxis protein CheY
#=GS A0A1E7LU07/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces nanshensis; 
#=GS A0A429USC1/148-244  AC A0A429USC1
#=GS A0A429USC1/148-244  OS Streptomyces sp. WAC04770
#=GS A0A429USC1/148-244  DE DNA-binding response regulator
#=GS A0A429USC1/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC04770; 
#=GS A0A1C6M9Z0/148-244  AC A0A1C6M9Z0
#=GS A0A1C6M9Z0/148-244  OS Streptomyces sp. AmelKG-D3
#=GS A0A1C6M9Z0/148-244  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C6M9Z0/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. AmelKG-D3; 
#=GS A0A1Q4WHK5/149-244  AC A0A1Q4WHK5
#=GS A0A1Q4WHK5/149-244  OS Streptomyces sp. CB02923
#=GS A0A1Q4WHK5/149-244  DE DNA-binding response regulator
#=GS A0A1Q4WHK5/149-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB02923; 
#=GS A0A0N0T2U7/149-245  AC A0A0N0T2U7
#=GS A0A0N0T2U7/149-245  OS Streptomyces sp. AS58
#=GS A0A0N0T2U7/149-245  DE Chemotaxis protein CheY
#=GS A0A0N0T2U7/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. AS58; 
#=GS A0A0T1S499/148-244  AC A0A0T1S499
#=GS A0A0T1S499/148-244  OS Streptomyces sp. Root1304
#=GS A0A0T1S499/148-244  DE Two-component system response regulator
#=GS A0A0T1S499/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Root1304; 
#=GS A0A3N6EGN6/149-245  AC A0A3N6EGN6
#=GS A0A3N6EGN6/149-245  OS Streptomyces sp. ADI96-15
#=GS A0A3N6EGN6/149-245  DE Transcriptional regulatory protein CseB
#=GS A0A3N6EGN6/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. ADI96-15; 
#=GS V4KJB4/149-245      AC V4KJB4
#=GS V4KJB4/149-245      OS Streptomyces sp. PVA 94-07
#=GS V4KJB4/149-245      DE Two-component system response regulator
#=GS V4KJB4/149-245      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. PVA 94-07; 
#=GS I2N623/149-245      AC I2N623
#=GS I2N623/149-245      OS Streptomyces tsukubensis NRRL18488
#=GS I2N623/149-245      DE Two component transcriptional regulator, winged helix family protein
#=GS I2N623/149-245      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces tsukubensis; 
#=GS A0A3R9WLX5/148-245  AC A0A3R9WLX5
#=GS A0A3R9WLX5/148-245  OS Streptomyces sp. WAC06614
#=GS A0A3R9WLX5/148-245  DE DNA-binding response regulator
#=GS A0A3R9WLX5/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC06614; 
#=GS A0A497W4N9/148-244  AC A0A497W4N9
#=GS A0A497W4N9/148-244  OS Streptomyces sp. 74
#=GS A0A497W4N9/148-244  DE DNA-binding response OmpR family regulator
#=GS A0A497W4N9/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 74; 
#=GS A0A1V1YSA1/148-244  AC A0A1V1YSA1
#=GS A0A1V1YSA1/148-244  OS Streptomyces sp. WAC00263
#=GS A0A1V1YSA1/148-244  DE DNA-binding response regulator
#=GS A0A1V1YSA1/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC00263; 
#=GS A0A2U0X877/148-244  AC A0A2U0X877
#=GS A0A2U0X877/148-244  OS Streptomyces sp. 3212.2
#=GS A0A2U0X877/148-244  DE DNA-binding response OmpR family regulator
#=GS A0A2U0X877/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 3212.2; 
#=GS A0A498BM61/148-244  AC A0A498BM61
#=GS A0A498BM61/148-244  OS Streptomyces sp. 57
#=GS A0A498BM61/148-244  DE DNA-binding response OmpR family regulator
#=GS A0A498BM61/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 57; 
#=GS A0A2A3J774/148-244  AC A0A2A3J774
#=GS A0A2A3J774/148-244  OS Streptomyces sp. Ag82_O1-15
#=GS A0A2A3J774/148-244  DE DNA-binding response OmpR family regulator
#=GS A0A2A3J774/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ag82_O1-15; 
#=GS A0A1I2J3H4/148-244  AC A0A1I2J3H4
#=GS A0A1I2J3H4/148-244  OS Streptomyces mirabilis
#=GS A0A1I2J3H4/148-244  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1I2J3H4/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces mirabilis; 
#=GS A0A2N3ZWH1/148-244  AC A0A2N3ZWH1
#=GS A0A2N3ZWH1/148-244  OS Streptomyces sp. OK885
#=GS A0A2N3ZWH1/148-244  DE DNA-binding response OmpR family regulator
#=GS A0A2N3ZWH1/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. OK885; 
#=GS A0A495CI94/148-244  AC A0A495CI94
#=GS A0A495CI94/148-244  OS Streptomyces sp. 42
#=GS A0A495CI94/148-244  DE DNA-binding response OmpR family regulator
#=GS A0A495CI94/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 42; 
#=GS A0A2C8XDJ3/148-244  AC A0A2C8XDJ3
#=GS A0A2C8XDJ3/148-244  OS Streptomyces sp. OK228
#=GS A0A2C8XDJ3/148-244  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A2C8XDJ3/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. OK228; 
#=GS A0A2G7C2S8/148-244  AC A0A2G7C2S8
#=GS A0A2G7C2S8/148-244  OS Streptomyces sp. 93
#=GS A0A2G7C2S8/148-244  DE DNA-binding response OmpR family regulator
#=GS A0A2G7C2S8/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 93; 
#=GS A0A250VAT3/148-244  AC A0A250VAT3
#=GS A0A250VAT3/148-244  OS Streptomyces olivochromogenes
#=GS A0A250VAT3/148-244  DE DNA-binding response regulator
#=GS A0A250VAT3/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces olivochromogenes; 
#=GS A0A2G7AIP0/148-244  AC A0A2G7AIP0
#=GS A0A2G7AIP0/148-244  OS Streptomyces sp. 94
#=GS A0A2G7AIP0/148-244  DE DNA-binding response OmpR family regulator
#=GS A0A2G7AIP0/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 94; 
#=GS A0A372M6B3/148-244  AC A0A372M6B3
#=GS A0A372M6B3/148-244  OS Streptomyces sp. NEAU-YY421
#=GS A0A372M6B3/148-244  DE DNA-binding response regulator
#=GS A0A372M6B3/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NEAU-YY421; 
#=GS A0A2A2YME3/148-244  AC A0A2A2YME3
#=GS A0A2A2YME3/148-244  OS Streptomyces sp. SA15
#=GS A0A2A2YME3/148-244  DE DNA-binding response regulator
#=GS A0A2A2YME3/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. SA15; 
#=GS A0A209BYI1/147-243  AC A0A209BYI1
#=GS A0A209BYI1/147-243  OS Streptomyces sp. CS113
#=GS A0A209BYI1/147-243  DE DNA-binding response regulator
#=GS A0A209BYI1/147-243  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CS113; 
#=GS D6EUK3/147-243      AC D6EUK3
#=GS D6EUK3/147-243      OS Streptomyces lividans TK24
#=GS D6EUK3/147-243      DE Two-component system response regulator
#=GS D6EUK3/147-243      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces lividans; 
#=GS A0A0N6ZHZ3/147-243  AC A0A0N6ZHZ3
#=GS A0A0N6ZHZ3/147-243  OS Streptomyces sp. CCM_MD2014
#=GS A0A0N6ZHZ3/147-243  DE Chemotaxis protein CheY
#=GS A0A0N6ZHZ3/147-243  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CCM_MD2014; 
#=GS A0A346C6F4/147-243  AC A0A346C6F4
#=GS A0A346C6F4/147-243  OS Streptomyces sp. CB09001
#=GS A0A346C6F4/147-243  DE DNA-binding response regulator
#=GS A0A346C6F4/147-243  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB09001; 
#=GS A0A397QHH4/147-243  AC A0A397QHH4
#=GS A0A397QHH4/147-243  OS Streptomyces sp. 19
#=GS A0A397QHH4/147-243  DE DNA-binding response OmpR family regulator
#=GS A0A397QHH4/147-243  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 19; 
#=GS A0A2S6XCP6/147-243  AC A0A2S6XCP6
#=GS A0A2S6XCP6/147-243  OS Streptomyces sp. MH60
#=GS A0A2S6XCP6/147-243  DE Alkaline phosphatase synthesis transcriptional regulatory protein PhoP
#=GS A0A2S6XCP6/147-243  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. MH60; 
#=GS A0A1R1WHE9/147-243  AC A0A1R1WHE9
#=GS A0A1R1WHE9/147-243  OS Streptomyces sp. M1013
#=GS A0A1R1WHE9/147-243  DE DNA-binding response regulator
#=GS A0A1R1WHE9/147-243  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. M1013; 
#=GS A0A1H2CWT6/147-243  AC A0A1H2CWT6
#=GS A0A1H2CWT6/147-243  OS Streptomyces sp. 2114.2
#=GS A0A1H2CWT6/147-243  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1H2CWT6/147-243  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 2114.2; 
#=GS A0A3Q8VVA2/147-243  AC A0A3Q8VVA2
#=GS A0A3Q8VVA2/147-243  OS Streptomyces sp. KPB2
#=GS A0A3Q8VVA2/147-243  DE Response regulator transcription factor
#=GS A0A3Q8VVA2/147-243  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. KPB2; 
#=GS A0A0N0YRK0/147-243  AC A0A0N0YRK0
#=GS A0A0N0YRK0/147-243  OS Streptomyces sp. NRRL WC-3753
#=GS A0A0N0YRK0/147-243  DE Chemotaxis protein CheY
#=GS A0A0N0YRK0/147-243  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL WC-3753; 
#=GS A0A3E0GL96/147-243  AC A0A3E0GL96
#=GS A0A3E0GL96/147-243  OS Streptomyces sp. 2221.1
#=GS A0A3E0GL96/147-243  DE DNA-binding response OmpR family regulator
#=GS A0A3E0GL96/147-243  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 2221.1; 
#=GS A0A209CJ52/147-243  AC A0A209CJ52
#=GS A0A209CJ52/147-243  OS Streptomyces sp. CS159
#=GS A0A209CJ52/147-243  DE DNA-binding response regulator
#=GS A0A209CJ52/147-243  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CS159; 
#=GS H1QIB4/147-243      AC H1QIB4
#=GS H1QIB4/147-243      OS Streptomyces coelicoflavus ZG0656
#=GS H1QIB4/147-243      DE Two-component system response regulator
#=GS H1QIB4/147-243      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces coelicoflavus; 
#=GS A0A3N1DRM9/147-243  AC A0A3N1DRM9
#=GS A0A3N1DRM9/147-243  OS Streptomyces sp. E5N91 SAI-083
#=GS A0A3N1DRM9/147-243  DE DNA-binding response OmpR family regulator
#=GS A0A3N1DRM9/147-243  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. E5N91 SAI-083; 
#=GS A0A2P8A6R1/147-243  AC A0A2P8A6R1
#=GS A0A2P8A6R1/147-243  OS Streptomyces sp. 111WW2
#=GS A0A2P8A6R1/147-243  DE Alkaline phosphatase synthesis transcriptional regulatory protein PhoP
#=GS A0A2P8A6R1/147-243  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 111WW2; 
#=GS A0A3B0BSU5/148-244  AC A0A3B0BSU5
#=GS A0A3B0BSU5/148-244  OS Streptomyces klenkii
#=GS A0A3B0BSU5/148-244  DE DNA-binding response regulator
#=GS A0A3B0BSU5/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces klenkii; 
#=GS A0A3R9XQE4/148-244  AC A0A3R9XQE4
#=GS A0A3R9XQE4/148-244  OS Streptomyces sp. WAC05374
#=GS A0A3R9XQE4/148-244  DE DNA-binding response regulator
#=GS A0A3R9XQE4/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC05374; 
#=GS C9ZA87/148-244      AC C9ZA87
#=GS C9ZA87/148-244      OS Streptomyces scabiei 87.22
#=GS C9ZA87/148-244      DE Putative two-component system response regulator
#=GS C9ZA87/148-244      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces scabiei; 
#=GS A0A2A3H046/148-244  AC A0A2A3H046
#=GS A0A2A3H046/148-244  OS Streptomyces sp. Tue6028
#=GS A0A2A3H046/148-244  DE DNA-binding response regulator
#=GS A0A2A3H046/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Tue6028; 
#=GS A0A1B6ACV0/169-265  AC A0A1B6ACV0
#=GS A0A1B6ACV0/169-265  OS Streptomyces sp. NBRC 110611
#=GS A0A1B6ACV0/169-265  DE Putative two-component response regulator
#=GS A0A1B6ACV0/169-265  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NBRC 110611; 
#=GS S4AQK2/149-245      AC S4AQK2
#=GS S4AQK2/149-245      OS Streptomyces aurantiacus JA 4570
#=GS S4AQK2/149-245      DE Putative transcriptional regulatory protein CseB
#=GS S4AQK2/149-245      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces aurantiacus; 
#=GS A0A1Z1WJ20/149-245  AC A0A1Z1WJ20
#=GS A0A1Z1WJ20/149-245  OS Streptomyces alboflavus
#=GS A0A1Z1WJ20/149-245  DE Putative transcriptional regulatory protein CseB
#=GS A0A1Z1WJ20/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces alboflavus; 
#=GS S5VMM0/149-245      AC S5VMM0
#=GS S5VMM0/149-245      OS Streptomyces collinus Tu 365
#=GS S5VMM0/149-245      DE Two-component system response regulator
#=GS S5VMM0/149-245      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces collinus; 
#=GS A0A3N6HAN8/148-244  AC A0A3N6HAN8
#=GS A0A3N6HAN8/148-244  OS Streptomyces sp. ADI96-02
#=GS A0A3N6HAN8/148-244  DE Alkaline phosphatase synthesis transcriptional regulatory protein PhoP
#=GS A0A3N6HAN8/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. ADI96-02; 
#=GS S2YU51/148-244      AC S2YU51
#=GS S2YU51/148-244      OS Streptomyces sp. HGB0020
#=GS S2YU51/148-244      DE Uncharacterized protein
#=GS S2YU51/148-244      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. HGB0020; 
#=GS A0A2T5ALK6/148-244  AC A0A2T5ALK6
#=GS A0A2T5ALK6/148-244  OS Streptomyces sp. VMFN-G11Ma
#=GS A0A2T5ALK6/148-244  DE DNA-binding response OmpR family regulator
#=GS A0A2T5ALK6/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. VMFN-G11Ma; 
#=GS A0A0K2AYK5/149-245  AC A0A0K2AYK5
#=GS A0A0K2AYK5/149-245  OS Streptomyces ambofaciens ATCC 23877
#=GS A0A0K2AYK5/149-245  DE Transcriptional regulatory protein CseB
#=GS A0A0K2AYK5/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces ambofaciens; 
#=GS A0A345HU52/148-244  AC A0A345HU52
#=GS A0A345HU52/148-244  OS Streptomyces sp. GSSD-12
#=GS A0A345HU52/148-244  DE DNA-binding response regulator
#=GS A0A345HU52/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. GSSD-12; 
#=GS A0A1G8WLC6/148-244  AC A0A1G8WLC6
#=GS A0A1G8WLC6/148-244  OS Streptomyces indicus
#=GS A0A1G8WLC6/148-244  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1G8WLC6/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces indicus; 
#=GS A0A0L8QHI4/91-187   AC A0A0L8QHI4
#=GS A0A0L8QHI4/91-187   OS Streptomyces varsoviensis
#=GS A0A0L8QHI4/91-187   DE Chemotaxis protein CheY
#=GS A0A0L8QHI4/91-187   DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces varsoviensis; 
#=GS A0A1Q5MBW4/149-245  AC A0A1Q5MBW4
#=GS A0A1Q5MBW4/149-245  OS Streptomyces sp. CB02400
#=GS A0A1Q5MBW4/149-245  DE Chemotaxis protein CheY
#=GS A0A1Q5MBW4/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB02400; 
#=GS A0A1X4I750/149-245  AC A0A1X4I750
#=GS A0A1X4I750/149-245  OS Streptomyces sp. 13-12-16
#=GS A0A1X4I750/149-245  DE DNA-binding response regulator
#=GS A0A1X4I750/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 13-12-16; 
#=GS A0A327VUF7/148-244  AC A0A327VUF7
#=GS A0A327VUF7/148-244  OS Streptomyces sp. PsTaAH-137
#=GS A0A327VUF7/148-244  DE DNA-binding response OmpR family regulator
#=GS A0A327VUF7/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. PsTaAH-137; 
#=GS A0A0H4C4U9/149-245  AC A0A0H4C4U9
#=GS A0A0H4C4U9/149-245  OS Streptomyces sp. PBH53
#=GS A0A0H4C4U9/149-245  DE Chemotaxis protein CheY
#=GS A0A0H4C4U9/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. PBH53; 
#=GS A0A255PGZ8/149-245  AC A0A255PGZ8
#=GS A0A255PGZ8/149-245  OS Streptomyces sp. FBKL.4005
#=GS A0A255PGZ8/149-245  DE DNA-binding response regulator
#=GS A0A255PGZ8/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. FBKL.4005; 
#=GS A0A0U5MDQ3/149-245  AC A0A0U5MDQ3
#=GS A0A0U5MDQ3/149-245  OS Streptomyces reticuli
#=GS A0A0U5MDQ3/149-245  DE Alkaline phosphatase synthesis transcriptional regulatory protein PhoP
#=GS A0A0U5MDQ3/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces reticuli; 
#=GS A0A2N3W1U1/148-244  AC A0A2N3W1U1
#=GS A0A2N3W1U1/148-244  OS Streptomyces sp. TLI_146
#=GS A0A2N3W1U1/148-244  DE DNA-binding response OmpR family regulator
#=GS A0A2N3W1U1/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. TLI_146; 
#=GS A0A197SPF5/148-244  AC A0A197SPF5
#=GS A0A197SPF5/148-244  OS Streptomyces sp. ERV7
#=GS A0A197SPF5/148-244  DE DNA-binding response regulator
#=GS A0A197SPF5/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. ERV7; 
#=GS A0A059W7Y0/149-244  AC A0A059W7Y0
#=GS A0A059W7Y0/149-244  OS Streptomyces albulus
#=GS A0A059W7Y0/149-244  DE DNA-binding response regulator
#=GS A0A059W7Y0/149-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albulus; 
#=GS A0A2M9MFX0/149-244  AC A0A2M9MFX0
#=GS A0A2M9MFX0/149-244  OS Streptomyces sp. CB02959
#=GS A0A2M9MFX0/149-244  DE DNA-binding response regulator
#=GS A0A2M9MFX0/149-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB02959; 
#=GS A0A101QV64/149-245  AC A0A101QV64
#=GS A0A101QV64/149-245  OS Streptomyces longwoodensis
#=GS A0A101QV64/149-245  DE Two-component system response regulator
#=GS A0A101QV64/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces longwoodensis; 
#=GS A0A176KUG1/148-244  AC A0A176KUG1
#=GS A0A176KUG1/148-244  OS Streptomyces sp. FXJ1.172
#=GS A0A176KUG1/148-244  DE DNA-binding response regulator
#=GS A0A176KUG1/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. FXJ1.172; 
#=GS V6KDC6/148-244      AC V6KDC6
#=GS V6KDC6/148-244      OS Streptomyces niveus NCIMB 11891
#=GS V6KDC6/148-244      DE Chemotaxis protein CheY
#=GS V6KDC6/148-244      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces niveus; 
#=GS A0A1B1AS72/149-245  AC A0A1B1AS72
#=GS A0A1B1AS72/149-245  OS Streptomyces griseochromogenes
#=GS A0A1B1AS72/149-245  DE DNA-binding response regulator
#=GS A0A1B1AS72/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseochromogenes; 
#=GS A0A124F5I8/149-245  AC A0A124F5I8
#=GS A0A124F5I8/149-245  OS Streptomyces albus subsp. albus
#=GS A0A124F5I8/149-245  DE Two-component system response regulator
#=GS A0A124F5I8/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus; Streptomyces albus subsp. albus; 
#=GS A0A2P2GIC4/147-243  AC A0A2P2GIC4
#=GS A0A2P2GIC4/147-243  OS Streptomyces showdoensis
#=GS A0A2P2GIC4/147-243  DE Chemotaxis protein CheY
#=GS A0A2P2GIC4/147-243  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces showdoensis; 
#=GS A0A1D2IEA3/149-245  AC A0A1D2IEA3
#=GS A0A1D2IEA3/149-245  OS Streptomyces sp. AVP053U2
#=GS A0A1D2IEA3/149-245  DE Alkaline phosphatase synthesis transcriptional regulatory protein PhoP
#=GS A0A1D2IEA3/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. AVP053U2; 
#=GS D5ZXM7/149-245      AC D5ZXM7
#=GS D5ZXM7/149-245      OS Streptomyces viridosporus ATCC 14672
#=GS D5ZXM7/149-245      DE Two-component system response regulator
#=GS D5ZXM7/149-245      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces viridosporus; 
#=GS A0A2U3HBZ4/149-245  AC A0A2U3HBZ4
#=GS A0A2U3HBZ4/149-245  OS Streptomyces sp. NWU49
#=GS A0A2U3HBZ4/149-245  DE DNA-binding response regulator
#=GS A0A2U3HBZ4/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NWU49; 
#=GS A0A1M5XBC5/149-245  AC A0A1M5XBC5
#=GS A0A1M5XBC5/149-245  OS Streptomyces sp. 3214.6
#=GS A0A1M5XBC5/149-245  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1M5XBC5/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 3214.6; 
#=GS A0A2G7A040/149-245  AC A0A2G7A040
#=GS A0A2G7A040/149-245  OS Streptomyces sp. 1121.2
#=GS A0A2G7A040/149-245  DE DNA-binding response OmpR family regulator
#=GS A0A2G7A040/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 1121.2; 
#=GS A0A081XPD1/149-245  AC A0A081XPD1
#=GS A0A081XPD1/149-245  OS Streptomyces toyocaensis
#=GS A0A081XPD1/149-245  DE Chemotaxis protein CheY
#=GS A0A081XPD1/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces toyocaensis; 
#=GS A0A2K2RGW6/149-245  AC A0A2K2RGW6
#=GS A0A2K2RGW6/149-245  OS Streptomyces sp. DH-12
#=GS A0A2K2RGW6/149-245  DE DNA-binding response regulator
#=GS A0A2K2RGW6/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. DH-12; 
#=GS A0A0J7ANI5/148-245  AC A0A0J7ANI5
#=GS A0A0J7ANI5/148-245  OS Streptomyces roseus
#=GS A0A0J7ANI5/148-245  DE Chemotaxis protein CheY
#=GS A0A0J7ANI5/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces roseus; 
#=GS A0A3N1UY02/148-245  AC A0A3N1UY02
#=GS A0A3N1UY02/148-245  OS Streptomyces sp. 2132.2
#=GS A0A3N1UY02/148-245  DE DNA-binding response OmpR family regulator
#=GS A0A3N1UY02/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 2132.2; 
#=GS A0A397R8D3/148-245  AC A0A397R8D3
#=GS A0A397R8D3/148-245  OS Streptomyces sp. 3211.1
#=GS A0A397R8D3/148-245  DE DNA-binding response OmpR family regulator
#=GS A0A397R8D3/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 3211.1; 
#=GS A0A2G7CIM6/148-245  AC A0A2G7CIM6
#=GS A0A2G7CIM6/148-245  OS Streptomyces sp. 61
#=GS A0A2G7CIM6/148-245  DE DNA-binding response OmpR family regulator
#=GS A0A2G7CIM6/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 61; 
#=GS A0A0N0S5P6/149-245  AC A0A0N0S5P6
#=GS A0A0N0S5P6/149-245  OS Streptomyces caelestis
#=GS A0A0N0S5P6/149-245  DE Chemotaxis protein CheY
#=GS A0A0N0S5P6/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces caelestis; 
#=GS A0A2P8PWK0/148-244  AC A0A2P8PWK0
#=GS A0A2P8PWK0/148-244  OS Streptomyces sp. A217
#=GS A0A2P8PWK0/148-244  DE DNA-binding response regulator
#=GS A0A2P8PWK0/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. A217; 
#=GS A0A3R9VW82/148-245  AC A0A3R9VW82
#=GS A0A3R9VW82/148-245  OS Streptomyces sp. WAC07061
#=GS A0A3R9VW82/148-245  DE DNA-binding response regulator
#=GS A0A3R9VW82/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC07061; 
#=GS D9VYQ5/148-245      AC D9VYQ5
#=GS D9VYQ5/148-245      OS Streptomyces sp. C
#=GS D9VYQ5/148-245      DE Phosphate regulon transcriptional regulatory protein PhoB
#=GS D9VYQ5/148-245      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. C; 
#=GS A0A3S8YDS4/148-245  AC A0A3S8YDS4
#=GS A0A3S8YDS4/148-245  OS Streptomyces sp. W1SF4
#=GS A0A3S8YDS4/148-245  DE Response regulator transcription factor
#=GS A0A3S8YDS4/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. W1SF4; 
#=GS A0A0Q8YNC7/149-245  AC A0A0Q8YNC7
#=GS A0A0Q8YNC7/149-245  OS Streptomyces sp. Root264
#=GS A0A0Q8YNC7/149-245  DE Two-component system response regulator
#=GS A0A0Q8YNC7/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Root264; 
#=GS A0A1Q5KUJ6/149-245  AC A0A1Q5KUJ6
#=GS A0A1Q5KUJ6/149-245  OS Streptomyces sp. TSRI0107
#=GS A0A1Q5KUJ6/149-245  DE Chemotaxis protein CheY
#=GS A0A1Q5KUJ6/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. TSRI0107; 
#=GS A0A1V9KFC2/148-244  AC A0A1V9KFC2
#=GS A0A1V9KFC2/148-244  OS Streptomyces sp. M41(2017)
#=GS A0A1V9KFC2/148-244  DE DNA-binding response regulator
#=GS A0A1V9KFC2/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. M41(2017); 
#=GS M3B9F5/148-244      AC M3B9F5
#=GS M3B9F5/148-244      OS Streptomyces mobaraensis NBRC 13819 = DSM 40847
#=GS M3B9F5/148-244      DE Winged helix family two component transcriptional regulator
#=GS M3B9F5/148-244      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces mobaraensis; 
#=GS A0A0X3W916/149-244  AC A0A0X3W916
#=GS A0A0X3W916/149-244  OS Streptomyces sp. NRRL F-4489
#=GS A0A0X3W916/149-244  DE Two-component system response regulator
#=GS A0A0X3W916/149-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL F-4489; 
#=GS A0A1B1MH20/148-244  AC A0A1B1MH20
#=GS A0A1B1MH20/148-244  OS Streptomyces lincolnensis
#=GS A0A1B1MH20/148-244  DE Two-component system response regulator
#=GS A0A1B1MH20/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces lincolnensis; 
#=GS A0A1G9PDQ2/150-246  AC A0A1G9PDQ2
#=GS A0A1G9PDQ2/150-246  OS Streptomyces wuyuanensis
#=GS A0A1G9PDQ2/150-246  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1G9PDQ2/150-246  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces wuyuanensis; 
#=GS A0A022MRH8/148-244  AC A0A022MRH8
#=GS A0A022MRH8/148-244  OS Streptomyces sp. Tu 6176
#=GS A0A022MRH8/148-244  DE Chemotaxis protein CheY
#=GS A0A022MRH8/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Tu 6176; 
#=GS A0A1A9J1Y9/148-244  AC A0A1A9J1Y9
#=GS A0A1A9J1Y9/148-244  OS Streptomyces sp. SAT1
#=GS A0A1A9J1Y9/148-244  DE DNA-binding response regulator
#=GS A0A1A9J1Y9/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. SAT1; 
#=GS A0A429N6F7/148-244  AC A0A429N6F7
#=GS A0A429N6F7/148-244  OS Streptomyces sp. WAC00469
#=GS A0A429N6F7/148-244  DE DNA-binding response regulator
#=GS A0A429N6F7/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC00469; 
#=GS A0A1A5P778/149-245  AC A0A1A5P778
#=GS A0A1A5P778/149-245  OS Streptomyces sp. H-KF8
#=GS A0A1A5P778/149-245  DE DNA-binding response regulator
#=GS A0A1A5P778/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. H-KF8; 
#=GS A0A2S1SWX7/150-246  AC A0A2S1SWX7
#=GS A0A2S1SWX7/150-246  OS Streptomyces tirandamycinicus
#=GS A0A2S1SWX7/150-246  DE DNA-binding response regulator
#=GS A0A2S1SWX7/150-246  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces tirandamycinicus; 
#=GS A0A0M9YXN5/148-244  AC A0A0M9YXN5
#=GS A0A0M9YXN5/148-244  OS Streptomyces sp. MMG1533
#=GS A0A0M9YXN5/148-244  DE Chemotaxis protein CheY
#=GS A0A0M9YXN5/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. MMG1533; 
#=GS A0A177HTG4/150-246  AC A0A177HTG4
#=GS A0A177HTG4/150-246  OS Streptomyces jeddahensis
#=GS A0A177HTG4/150-246  DE Alkaline phosphatase synthesis transcriptional regulatory protein PhoP
#=GS A0A177HTG4/150-246  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces jeddahensis; 
#=GS A0A1D8G6E9/148-244  AC A0A1D8G6E9
#=GS A0A1D8G6E9/148-244  OS Streptomyces rubrolavendulae
#=GS A0A1D8G6E9/148-244  DE Alkaline phosphatase synthesis transcriptional regulatory protein PhoP
#=GS A0A1D8G6E9/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces rubrolavendulae; 
#=GS A0A0F5VRS5/149-245  AC A0A0F5VRS5
#=GS A0A0F5VRS5/149-245  OS Streptomyces sp. WM6386
#=GS A0A0F5VRS5/149-245  DE Chemotaxis protein CheY
#=GS A0A0F5VRS5/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WM6386; 
#=GS A0A1V4DP95/149-245  AC A0A1V4DP95
#=GS A0A1V4DP95/149-245  OS Streptomyces sp. GKU 895
#=GS A0A1V4DP95/149-245  DE DNA-binding response regulator
#=GS A0A1V4DP95/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. GKU 895; 
#=GS A0A2U2ZTK9/149-245  AC A0A2U2ZTK9
#=GS A0A2U2ZTK9/149-245  OS Streptomyces sp. Act143
#=GS A0A2U2ZTK9/149-245  DE DNA-binding response regulator
#=GS A0A2U2ZTK9/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Act143; 
#=GS A0A117P0F2/148-244  AC A0A117P0F2
#=GS A0A117P0F2/148-244  OS Streptomyces curacoi
#=GS A0A117P0F2/148-244  DE Two-component system response regulator
#=GS A0A117P0F2/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces curacoi; 
#=GS A0A3N4V798/148-244  AC A0A3N4V798
#=GS A0A3N4V798/148-244  OS Streptomyces sp. Ag82_G5-5
#=GS A0A3N4V798/148-244  DE DNA-binding response OmpR family regulator
#=GS A0A3N4V798/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ag82_G5-5; 
#=GS A0A1C6MPQ9/150-246  AC A0A1C6MPQ9
#=GS A0A1C6MPQ9/150-246  OS Streptomyces sp. AmelKG-E11A
#=GS A0A1C6MPQ9/150-246  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C6MPQ9/150-246  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. AmelKG-E11A; 
#=GS A0A1Q4VF70/150-246  AC A0A1Q4VF70
#=GS A0A1Q4VF70/150-246  OS Streptomyces uncialis
#=GS A0A1Q4VF70/150-246  DE Chemotaxis protein CheY
#=GS A0A1Q4VF70/150-246  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces uncialis; 
#=GS A0A0X3SF17/148-244  AC A0A0X3SF17
#=GS A0A0X3SF17/148-244  OS Streptomyces sp. NRRL F-5122
#=GS A0A0X3SF17/148-244  DE Two-component system response regulator
#=GS A0A0X3SF17/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL F-5122; 
#=GS A0A3D9QRT4/148-244  AC A0A3D9QRT4
#=GS A0A3D9QRT4/148-244  OS Streptomyces sp. 3212.3
#=GS A0A3D9QRT4/148-244  DE DNA-binding response OmpR family regulator
#=GS A0A3D9QRT4/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 3212.3; 
#=GS A0A2S4XX58/149-244  AC A0A2S4XX58
#=GS A0A2S4XX58/149-244  OS Streptomyces sp. Ru73
#=GS A0A2S4XX58/149-244  DE DNA-binding response regulator
#=GS A0A2S4XX58/149-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ru73; 
#=GS A0A101NAI3/148-244  AC A0A101NAI3
#=GS A0A101NAI3/148-244  OS Streptomyces pseudovenezuelae
#=GS A0A101NAI3/148-244  DE Two-component system response regulator
#=GS A0A101NAI3/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces pseudovenezuelae; 
#=GS A0A3R8STP4/148-244  AC A0A3R8STP4
#=GS A0A3R8STP4/148-244  OS Streptomyces sp. RP5T
#=GS A0A3R8STP4/148-244  DE Response regulator transcription factor
#=GS A0A3R8STP4/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. RP5T; 
#=GS A0A2S4YR90/148-244  AC A0A2S4YR90
#=GS A0A2S4YR90/148-244  OS Streptomyces sp. Ru72
#=GS A0A2S4YR90/148-244  DE DNA-binding response regulator
#=GS A0A2S4YR90/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ru72; 
#=GS A0A2K8PCM4/148-245  AC A0A2K8PCM4
#=GS A0A2K8PCM4/148-245  OS Streptomyces lavendulae subsp. lavendulae
#=GS A0A2K8PCM4/148-245  DE Transcriptional regulatory protein CseB
#=GS A0A2K8PCM4/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces lavendulae; Streptomyces lavendulae subsp. lavendulae; 
#=GS A0A3L8JZL6/148-244  AC A0A3L8JZL6
#=GS A0A3L8JZL6/148-244  OS Streptomyces griseocarneus
#=GS A0A3L8JZL6/148-244  DE DNA-binding response regulator
#=GS A0A3L8JZL6/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseocarneus; 
#=GS A0A370BCF5/148-244  AC A0A370BCF5
#=GS A0A370BCF5/148-244  OS Streptomyces sp. AC230
#=GS A0A370BCF5/148-244  DE DNA-binding response regulator
#=GS A0A370BCF5/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. AC230; 
#=GS A0A1H4TS11/149-245  AC A0A1H4TS11
#=GS A0A1H4TS11/149-245  OS Streptomyces melanosporofaciens
#=GS A0A1H4TS11/149-245  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1H4TS11/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces melanosporofaciens group; Streptomyces melanosporofaciens; 
#=GS A0A3R9V896/149-245  AC A0A3R9V896
#=GS A0A3R9V896/149-245  OS Streptomyces sp. WAC05858
#=GS A0A3R9V896/149-245  DE DNA-binding response regulator
#=GS A0A3R9V896/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC05858; 
#=GS A0A0J8BSK0/148-244  AC A0A0J8BSK0
#=GS A0A0J8BSK0/148-244  OS Streptomyces viridochromogenes
#=GS A0A0J8BSK0/148-244  DE Chemotaxis protein CheY
#=GS A0A0J8BSK0/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces viridochromogenes; 
#=GS A0A101U4X0/148-244  AC A0A101U4X0
#=GS A0A101U4X0/148-244  OS Streptomyces caeruleatus
#=GS A0A101U4X0/148-244  DE Two-component system response regulator
#=GS A0A101U4X0/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces caeruleatus; 
#=GS A0A1H0DDB2/148-244  AC A0A1H0DDB2
#=GS A0A1H0DDB2/148-244  OS Streptomyces sp. cf386
#=GS A0A1H0DDB2/148-244  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1H0DDB2/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. cf386; 
#=GS A0A0C1XHR5/148-244  AC A0A0C1XHR5
#=GS A0A0C1XHR5/148-244  OS Streptomyces sp. AcH 505
#=GS A0A0C1XHR5/148-244  DE Chemotaxis protein CheY
#=GS A0A0C1XHR5/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. AcH 505; 
#=GS A0A0U3G4E0/148-244  AC A0A0U3G4E0
#=GS A0A0U3G4E0/148-244  OS Streptomyces sp. CdTB01
#=GS A0A0U3G4E0/148-244  DE Two-component system response regulator
#=GS A0A0U3G4E0/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CdTB01; 
#=GS A0A2R4JG03/149-245  AC A0A2R4JG03
#=GS A0A2R4JG03/149-245  OS Streptomyces sp. P3
#=GS A0A2R4JG03/149-245  DE DNA-binding response regulator
#=GS A0A2R4JG03/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. P3; 
#=GS A0A1V9WH04/149-245  AC A0A1V9WH04
#=GS A0A1V9WH04/149-245  OS Streptomyces sp. B9173
#=GS A0A1V9WH04/149-245  DE DNA-binding response regulator
#=GS A0A1V9WH04/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. B9173; 
#=GS A0A0T1TPY3/149-245  AC A0A0T1TPY3
#=GS A0A0T1TPY3/149-245  OS Streptomyces sp. Root1310
#=GS A0A0T1TPY3/149-245  DE Two-component system response regulator
#=GS A0A0T1TPY3/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Root1310; 
#=GS A0A2G7F5W5/148-244  AC A0A2G7F5W5
#=GS A0A2G7F5W5/148-244  OS Streptomyces sp. 70
#=GS A0A2G7F5W5/148-244  DE DNA-binding response OmpR family regulator
#=GS A0A2G7F5W5/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 70; 
#=GS A0A1Q4ZL88/148-244  AC A0A1Q4ZL88
#=GS A0A1Q4ZL88/148-244  OS Streptomyces sp. TSRI0281
#=GS A0A1Q4ZL88/148-244  DE DNA-binding response regulator
#=GS A0A1Q4ZL88/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. TSRI0281; 
#=GS A0A117RDN8/149-245  AC A0A117RDN8
#=GS A0A117RDN8/149-245  OS Streptomyces griseoruber
#=GS A0A117RDN8/149-245  DE Two-component system response regulator
#=GS A0A117RDN8/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseoruber; 
#=GS A0A101UJ35/149-245  AC A0A101UJ35
#=GS A0A101UJ35/149-245  OS Streptomyces sp. DSM 15324
#=GS A0A101UJ35/149-245  DE Two-component system response regulator
#=GS A0A101UJ35/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. DSM 15324; 
#=GS Q82J12/148-244      AC Q82J12
#=GS Q82J12/148-244      OS Streptomyces avermitilis MA-4680 = NBRC 14893
#=GS Q82J12/148-244      DE Putative two-component system response regulator
#=GS Q82J12/148-244      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces avermitilis; 
#=GS A0A1S2KDT1/148-244  AC A0A1S2KDT1
#=GS A0A1S2KDT1/148-244  OS Streptomyces sp. CC53
#=GS A0A1S2KDT1/148-244  DE DNA-binding response regulator
#=GS A0A1S2KDT1/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CC53; 
#=GS A0A0B5DGZ4/148-244  AC A0A0B5DGZ4
#=GS A0A0B5DGZ4/148-244  OS Streptomyces nodosus
#=GS A0A0B5DGZ4/148-244  DE Chemotaxis protein CheY
#=GS A0A0B5DGZ4/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces nodosus; 
#=GS G2G523/148-244      AC G2G523
#=GS G2G523/148-244      OS Streptomyces zinciresistens K42
#=GS G2G523/148-244      DE Two-component system response regulator
#=GS G2G523/148-244      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces zinciresistens; 
#=GS A0A117RXD1/148-244  AC A0A117RXD1
#=GS A0A117RXD1/148-244  OS Streptomyces sp. RV15
#=GS A0A117RXD1/148-244  DE Two-component system response regulator
#=GS A0A117RXD1/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. RV15; 
#=GS A0A1J4NXC8/149-245  AC A0A1J4NXC8
#=GS A0A1J4NXC8/149-245  OS Streptomyces mangrovisoli
#=GS A0A1J4NXC8/149-245  DE DNA-binding response regulator
#=GS A0A1J4NXC8/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces mangrovisoli; 
#=GS A0A1S2NX13/148-244  AC A0A1S2NX13
#=GS A0A1S2NX13/148-244  OS Streptomyces sp. MUSC 93
#=GS A0A1S2NX13/148-244  DE DNA-binding response regulator
#=GS A0A1S2NX13/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. MUSC 93; 
#=GS A0A2N5XJN2/146-243  AC A0A2N5XJN2
#=GS A0A2N5XJN2/146-243  OS Streptomyces sp. DJ
#=GS A0A2N5XJN2/146-243  DE DNA-binding response regulator
#=GS A0A2N5XJN2/146-243  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. DJ; 
#=GS A0A1Q5N2D3/148-245  AC A0A1Q5N2D3
#=GS A0A1Q5N2D3/148-245  OS Streptomyces sp. CB00455
#=GS A0A1Q5N2D3/148-245  DE Chemotaxis protein CheY
#=GS A0A1Q5N2D3/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB00455; 
#=GS A0A160P5P6/148-244  AC A0A160P5P6
#=GS A0A160P5P6/148-244  OS Streptomyces laurentii
#=GS A0A160P5P6/148-244  DE Two-component system response regulator
#=GS A0A160P5P6/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces laurentii; 
#=GS A0A1G5GH42/148-244  AC A0A1G5GH42
#=GS A0A1G5GH42/148-244  OS Streptomyces sp. 136MFCol5.1
#=GS A0A1G5GH42/148-244  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1G5GH42/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 136MFCol5.1; 
#=GS A0A1A9CP97/148-244  AC A0A1A9CP97
#=GS A0A1A9CP97/148-244  OS Streptomyces sp. Ncost-T6T-1
#=GS A0A1A9CP97/148-244  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1A9CP97/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ncost-T6T-1; 
#=GS A0A1X2N0S4/148-244  AC A0A1X2N0S4
#=GS A0A1X2N0S4/148-244  OS Streptomyces sp. BF-3
#=GS A0A1X2N0S4/148-244  DE DNA-binding response regulator
#=GS A0A1X2N0S4/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. BF-3; 
#=GS A0A1L6PGU2/148-244  AC A0A1L6PGU2
#=GS A0A1L6PGU2/148-244  OS Streptomyces sp. Tue 6075
#=GS A0A1L6PGU2/148-244  DE Chemotaxis protein CheY
#=GS A0A1L6PGU2/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Tue 6075; 
#=GS A0A2T7LT45/148-244  AC A0A2T7LT45
#=GS A0A2T7LT45/148-244  OS Streptomyces sp. CS147
#=GS A0A2T7LT45/148-244  DE DNA-binding response regulator
#=GS A0A2T7LT45/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CS147; 
#=GS A0A2P8BAY6/148-244  AC A0A2P8BAY6
#=GS A0A2P8BAY6/148-244  OS Streptomyces sp. CS149
#=GS A0A2P8BAY6/148-244  DE DNA-binding response regulator
#=GS A0A2P8BAY6/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CS149; 
#=GS A0A2T7KHT5/148-244  AC A0A2T7KHT5
#=GS A0A2T7KHT5/148-244  OS Streptomyces sp. CS131
#=GS A0A2T7KHT5/148-244  DE DNA-binding response regulator
#=GS A0A2T7KHT5/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CS131; 
#=GS A0A212QYG2/148-244  AC A0A212QYG2
#=GS A0A212QYG2/148-244  OS Streptomyces sp. PgraA7
#=GS A0A212QYG2/148-244  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A212QYG2/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. PgraA7; 
#=GS A0A1C5EYD6/148-244  AC A0A1C5EYD6
#=GS A0A1C5EYD6/148-244  OS Streptomyces sp. Ncost-T6T-2b
#=GS A0A1C5EYD6/148-244  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C5EYD6/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ncost-T6T-2b; 
#=GS W9FV01/148-244      AC W9FV01
#=GS W9FV01/148-244      OS Streptomyces filamentosus NRRL 11379
#=GS W9FV01/148-244      DE Phosphate regulon transcriptional regulatory protein PhoB
#=GS W9FV01/148-244      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces filamentosus; 
#=GS A0A2T7M2N8/148-244  AC A0A2T7M2N8
#=GS A0A2T7M2N8/148-244  OS Streptomyces sp. CS014
#=GS A0A2T7M2N8/148-244  DE DNA-binding response regulator
#=GS A0A2T7M2N8/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CS014; 
#=GS A0A1C4RKG1/148-244  AC A0A1C4RKG1
#=GS A0A1C4RKG1/148-244  OS Streptomyces sp. Termitarium-T10T-6
#=GS A0A1C4RKG1/148-244  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C4RKG1/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Termitarium-T10T-6; 
#=GS A0A2M9LKL4/148-244  AC A0A2M9LKL4
#=GS A0A2M9LKL4/148-244  OS Streptomyces sp. CB02613
#=GS A0A2M9LKL4/148-244  DE DNA-binding response regulator
#=GS A0A2M9LKL4/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB02613; 
#=GS A0A1Q5HGB0/148-243  AC A0A1Q5HGB0
#=GS A0A1Q5HGB0/148-243  OS Streptomyces sp. CB01580
#=GS A0A1Q5HGB0/148-243  DE Chemotaxis protein CheY
#=GS A0A1Q5HGB0/148-243  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CB01580; 
#=GS A0A1C5F0N7/148-244  AC A0A1C5F0N7
#=GS A0A1C5F0N7/148-244  OS Streptomyces sp. MnatMP-M17
#=GS A0A1C5F0N7/148-244  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1C5F0N7/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. MnatMP-M17; 
#=GS A0A2S9Q0H7/150-246  AC A0A2S9Q0H7
#=GS A0A2S9Q0H7/150-246  OS Streptomyces sp. ST5x
#=GS A0A2S9Q0H7/150-246  DE DNA-binding response regulator
#=GS A0A2S9Q0H7/150-246  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. ST5x; 
#=GS K4R2A6/148-244      AC K4R2A6
#=GS K4R2A6/148-244      OS Streptomyces davaonensis JCM 4913
#=GS K4R2A6/148-244      DE Two-component system response regulator
#=GS K4R2A6/148-244      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces davaonensis; 
#=GS A0A1H9MYZ7/148-244  AC A0A1H9MYZ7
#=GS A0A1H9MYZ7/148-244  OS Streptomyces sp. yr375
#=GS A0A1H9MYZ7/148-244  DE DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain
#=GS A0A1H9MYZ7/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. yr375; 
#=GS D7CHE5/149-245      AC D7CHE5
#=GS D7CHE5/149-245      OS Streptomyces bingchenggensis BCW-1
#=GS D7CHE5/149-245      DE Two-component system response regulator
#=GS D7CHE5/149-245      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces bingchenggensis; 
#=GS S3C094/152-248      AC S3C094
#=GS S3C094/152-248      OS Streptomyces sp. HPH0547
#=GS S3C094/152-248      DE Uncharacterized protein
#=GS S3C094/152-248      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. HPH0547; 
#=GS A0A0N1KBC3/152-248  AC A0A0N1KBC3
#=GS A0A0N1KBC3/152-248  OS Streptomyces sp. NRRL F-6602
#=GS A0A0N1KBC3/152-248  DE Chemotaxis protein CheY
#=GS A0A0N1KBC3/152-248  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL F-6602; 
#=GS A0A429T9T9/148-245  AC A0A429T9T9
#=GS A0A429T9T9/148-245  OS Streptomyces sp. WAC07149
#=GS A0A429T9T9/148-245  DE DNA-binding response regulator
#=GS A0A429T9T9/148-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. WAC07149; 
#=GS A0A3M0IFW5/149-245  AC A0A3M0IFW5
#=GS A0A3M0IFW5/149-245  OS Streptomyces shenzhenensis
#=GS A0A3M0IFW5/149-245  DE DNA-binding response regulator
#=GS A0A3M0IFW5/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces shenzhenensis; 
#=GS A0A101SUZ3/148-244  AC A0A101SUZ3
#=GS A0A101SUZ3/148-244  OS Streptomyces bungoensis
#=GS A0A101SUZ3/148-244  DE Two-component system response regulator
#=GS A0A101SUZ3/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces bungoensis; 
#=GS A0A1D7Y9F9/149-245  AC A0A1D7Y9F9
#=GS A0A1D7Y9F9/149-245  OS Streptomyces puniciscabiei
#=GS A0A1D7Y9F9/149-245  DE DNA-binding response regulator
#=GS A0A1D7Y9F9/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces puniciscabiei; 
#=GS A0A0S1UIS6/128-224  AC A0A0S1UIS6
#=GS A0A0S1UIS6/128-224  OS Streptomyces sp. FR-008
#=GS A0A0S1UIS6/128-224  DE Chemotaxis protein CheY
#=GS A0A0S1UIS6/128-224  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. FR-008; 
#=GS A0A423V3P2/148-244  AC A0A423V3P2
#=GS A0A423V3P2/148-244  OS Streptomyces globisporus
#=GS A0A423V3P2/148-244  DE DNA-binding response regulator
#=GS A0A423V3P2/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseus group; Streptomyces albovinaceus subgroup; Streptomyces globisporus; 
#=GS A0A0M3QI94/160-256  AC A0A0M3QI94
#=GS A0A0M3QI94/160-256  OS Streptomyces pristinaespiralis
#=GS A0A0M3QI94/160-256  DE Two-component system response regulator
#=GS A0A0M3QI94/160-256  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces pristinaespiralis; 
#=GS X0NHP2/149-244      AC X0NHP2
#=GS X0NHP2/149-244      OS Streptomyces albulus PD-1
#=GS X0NHP2/149-244      DE Chemotaxis protein CheY
#=GS X0NHP2/149-244      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albulus; 
#=GS A0A0B5EWC3/149-245  AC A0A0B5EWC3
#=GS A0A0B5EWC3/149-245  OS Streptomyces albus subsp. albus DSM 41398
#=GS A0A0B5EWC3/149-245  DE Two-component system response regulator
#=GS A0A0B5EWC3/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus; Streptomyces albus subsp. albus; 
#=GS A0A1Y2NQH3/148-244  AC A0A1Y2NQH3
#=GS A0A1Y2NQH3/148-244  OS Streptomyces fradiae ATCC 10745 = DSM 40063
#=GS A0A1Y2NQH3/148-244  DE Alkaline phosphatase synthesis transcriptional regulatory protein PhoP
#=GS A0A1Y2NQH3/148-244  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces fradiae; 
#=GS A0A1V4ACS5/149-245  AC A0A1V4ACS5
#=GS A0A1V4ACS5/149-245  OS Streptomyces tsukubensis
#=GS A0A1V4ACS5/149-245  DE DNA-binding response regulator
#=GS A0A1V4ACS5/149-245  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces tsukubensis; 
#=GS L8PJK4/148-244      AC L8PJK4
#=GS L8PJK4/148-244      OS Streptomyces viridochromogenes Tue57
#=GS L8PJK4/148-244      DE Putative two-component system response regulator
#=GS L8PJK4/148-244      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces viridochromogenes; 
#=GS D6AML7/148-244      AC D6AML7
#=GS D6AML7/148-244      OS Streptomyces filamentosus NRRL 15998
#=GS D6AML7/148-244      DE Two-component system response regulator
#=GS D6AML7/148-244      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces filamentosus; 
#=GF SQ 357
Q9FBR2/147-243              -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A0N0MMH6/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2P7PHU0/148-244          -SGILRLGELEIDHAQRRVRVRGADVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0N1G762/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A0N1HDI0/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1V0VDB1/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A150VUF3/148-244          -SGILRLGELEIDHAQRRVRVRTEDVHLTPTEFDLLVCLASTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A2T7JVI6/148-244          -SGILRLGELEIDHAQRRVRVRTEDVHLTPTEFDLLVCLASTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A429Q2I7/148-244          -SGILRLGELEIDHAQRRVRVRTEDVHLTPTEFDLLVCLASTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A2L2PUK3/148-244          -SGILRLGELEIDHAQRRVRVRTEDVHLTPTEFDLLVCLASTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A2N8NR31/148-244          -SGILRLGELEIDHAQRRVRVRGEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1Z2L0U8/148-244          -SGILRLGELEIDHAQRRVRVRGEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1Q5ILS8/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1B9EIQ0/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0Q7HXB2/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1Q5AIE7/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1Q8U4Z9/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A384HMK9/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1Q5ESM3/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1Q5CF08/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A209D668/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0Q8E4P7/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1E5P667/148-243          -SGILRLGELEIDHAQRRVRVRGDDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETP--
A0A367ENE4/152-248          -NGILRLGELEIDHAQRRVRVGGEDVHLTPTEFDLLVCLAHSPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPG-
A0A2U9P7G9/148-244          -SGILRLGELEIDHAQRRVRVKSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A344TWE4/149-246          -GATLRLGDLEIDHAQRRVRVQAEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A399CP48/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A454W6V0/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A429NX23/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2T7T7V5/148-244          -SGILRLGELEIDHAQRRVRVRGDDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A371Q8M3/149-244          -TGILRLGELEIDHAQRRVRVRGADVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETP--
A0A2U2ZEV8/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2L2MIX4/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2G5J0W2/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
B5H4B5/148-244              -SGILRLGELEIDHAQRRVRVRGDDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A429AHQ6/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A3S8WT18/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A429HEX8/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A428ZSX5/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A3Q9EX13/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2S1IIC9/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A0X3XJF7/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1H4YGK4/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A370VRW7/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1D7VTG9/148-244          -SGILRLGELEIDHAQRRVRVRGADVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0A0NKZ1/149-245          -SGILRLGELEIDHAQRRVRVRGSDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A060ZTC4/149-245          -SGILRLGELEIDHAQRRVRVRGSDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A291SXC8/149-245          -SGILRLGELEIDHAQRRVRVRGSDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A222T210/149-245          -SGILRLGELEIDHAQRRVRVRGSDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1P8Y0Q3/149-245          -SGILRLGELEIDHAQRRVRVRGSDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A2K8R452/149-245          -SGILRLGELEIDHAQRRVRVRGSDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1C5FDJ4/149-245          -SGILRLGELEIDHAQRRVRVRGSDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
G2P239/149-245              -SGILRLGELEIDHAQRRVRVRGSDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1S6RR26/149-245          -SGILRLGELEIDHAQRRVRVRGSDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A014N2Q6/149-245          -SGILRLGELEIDHAQRRVRVRGSDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A2Z4UZH1/149-246          -GATLRLGDLEIDHAQRRVRVHTEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A089XH55/168-264          -SGILRLGELEIDHAQRRVRVKSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2S4Z384/148-244          -SGVMRLGELEIDHAQRRVRVKSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A221P426/149-245          -SGILRLGELEIDHAQRRVRVKSEDIHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYSLETPA-
A0A0M2GFY8/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A286CNB0/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A0N0TG99/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2T4NLC3/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A143C5Y8/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2S6WF79/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2N8TJ27/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1H5K360/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2D3UK79/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0C2BF06/148-244          -SGILRLGELEIDHAQRRVRVRGEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0M8TNT2/148-245          -GATLRLGDLEIDHAQRRVRVHTEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A2W2L7D3/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A0M8YLK9/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLASTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1Q5LWY6/148-244          -SGILRLGELEIDHAQRRVRVKGEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1K2FXW1/150-246          -SGILRLGELEIDHAQRRVRVKSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1H5BX44/150-246          -SGILRLGELEIDHAQRRVRVKSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A3Q9C490/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
M3D9L3/149-245              -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2U3C4W6/152-247          --GTLQLGDLSIDHAQRRVRVRGDDVHLTPTEFDLLACLAQTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0A8EJJ4/154-249          -SGILRLGELEIDHAQRRVRVRGADVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETP--
A0A1J4Q3F1/150-246          -SGILRLGELEIDHAQRRVRVKSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPN-
A0A494V6D4/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
D9XM91/149-245              -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A291QG50/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
F2R2X9/148-244              -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
F8JPD5/152-247              --GTLQLGDLAIDHAQRRVRVRGDDVHLTPTEFDLLACLAQTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A2N0IYZ2/149-245          -SGILRLGELEIDHAQRRVRVKSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1C4M2G9/170-266          -SGVLRLGELEVDHAQRRVRVRGEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
D9UU16/170-266              -SGVLRLGELEVDHAQRRVRVRGEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0T1QB90/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLASTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A3R9WVT4/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLASTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1R1SPG8/149-245          -SGILRLGELEIDHAQRRVRVRGTDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
F3NN15/148-244              -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1G7GDA3/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A0C5FUN5/149-245          -SGILRLGELEIDHAQRRVRVKSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A3G2JDL2/149-245          -SGILRLGELEIDHAQRRVRVKAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A2M9IMU3/148-244          -SGILRLGELEIDHAQRRVRVRGEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1H5J675/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2I0SKS3/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2R4T7Z6/148-244          -SGILRLGELEVDHAQRRVRVRGEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0T6LS81/148-244          -SGTLHLGDLEIDHAQRRVRVRSLDVHLTPTEFDLLVCLAQTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A353KI61/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
G2NM64/148-244              -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A327T4D1/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A437PDJ8/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A371XT27/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
D6K0L2/148-244              -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A3Q9FWL6/148-244          -SGILRLGELEIDHAQRRVRVRGGDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1E5PVU6/148-245          -GATLRLGDLEIDHAQRRVRVQAEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A2G1XDE3/148-244          -SGILRLGELEIDHAQRRVRVRGADVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A3M8TXX9/149-245          -SGILRLGELEIDHAQRRVRVRGSDVHLTPTEFDLLVCLANSPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
D9WG74/149-245              -SGILRLGELEIDHAQRRVRVRGSDVHLTPTEFDLLVCLANSPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0N0A3Z6/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1D8SUH3/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPN-
A0A429SG76/149-246          -GATLRLGDLEIDHAQRRVRVQAEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A1V0TWN1/149-245          -SGILRLGELEIDHAQRRVRVRGADVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0D7CFD2/149-245          -SGILRLGELEIDHAQRRVRVRGADVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A2G9DQG5/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A3N1LQP6/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2P9FDJ3/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A100Y448/148-244          -SGILRLGELEIDHAQRRVRVRNDDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0K9XET1/148-244          -SGILRLGELEIDHAQRRVRVRGADVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0W7WZW4/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2N0GTY3/148-245          -GATLRLGDLEIDHAQRRVRVQAEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A3N5AKY1/148-245          -GATLRLGDLEIDHAQRRVRVQAEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A0C1VKE5/147-244          -GATLRLGDLEIDHAQRRVRVQAEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A0M9Z8F3/148-245          -GATLRLGDLEIDHAQRRVRVQTEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A1L7GJP3/148-245          -GATLRLGDLEIDHAQRRVRVQTEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A0M8UKM7/148-245          -GATLRLGDLEIDHAQRRVRVQTEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A0F0GTZ5/148-245          -GATLRLGDLEIDHAQRRVRVQTEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A1U9P2G9/148-245          -GATLRLGDLEIDHAQRRVRVQTEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A3R9X4V5/148-245          -GATLRLGDLEIDHAQRRVRVQTEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A0F4I512/148-245          -GATLRLGDLEIDHAQRRVRVQTEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A0G3AIW8/149-245          -SGILRLGELEIDHAQRRVRVKSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A101P041/149-245          -SGILRLGELEIDHAQRRVRVKSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A101NIX9/149-245          -SGILRLGELEIDHAQRRVRVKSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A0N0AET6/149-245          -SGILRLGELEIDHAQRRVRVKSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPN-
A0A367H9L1/148-244          -TGILRLGELEIDHAQRRVRVRGEDVHLTPTEFDLLSCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0M8SGV7/148-244          -TGILRLGELEIDHAQRRVRVRGEDVHLTPTEFDLLSCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A2M9IUJ3/148-244          -TGILRLGELEIDHAQRRVRVRGEDVHLTPTEFDLLSCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1Q5E351/148-244          -SGILRLGELEIDHAQRRVRVRADDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A3G4VYB6/148-245          -GATLRLGDLEIDHAQRRVRVHNEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A2M9KAN1/148-245          -GATLRLGDLEIDHAQRRVRVHNEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A1Q5BDC5/148-245          -GATLRLGDLEIDHAQRRVRVHNEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
B4VF41/148-245              -GATLRLGDLEIDHAQRRVRVHNEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A1Q4Y4F8/148-245          -GATLRLGDLEIDHAQRRVRVHNEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A3N6DG31/148-245          -GATLRLGDLEIDHAQRRVRVHNEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A1X7FLA1/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
L1KHY7/148-244              -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
V6KL06/149-245              -SGILRLGELEIDHAQRRVRVKSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2V2Q5E3/148-244          -SGILRLGELEIDHAQRRVRVRADDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1C6P2N2/148-244          -SGILRLGELEIDHAQRRVRVRADDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1Q5DQU6/148-244          -SGILRLGELEIDHAQRRVRVRADDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0N0YFR9/148-244          -SGILRLGELEIDHAQRRVRVRADDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
E8WCN7/148-244              -SGILRLGELEIDHAQRRVRVRADDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1C5C202/148-244          -SGILRLGELEIDHAQRRVRVRADDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A2S6PUD8/148-244          -SGILRLGELEIDHAQRRVRVRADDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A3N1SL45/148-244          -SGILRLGELEIDHAQRRVRVRADDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A329CAX1/148-244          -SGILRLGELEIDHAQRRVRVRADDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A3N6EXC8/148-244          -SGILRLGELEIDHAQRRVRVRADDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1Q5MNN8/148-244          -SGILRLGELEIDHAQRRVRVRADDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1C4SCN1/148-244          -SGILRLGELEIDHAQRRVRVRADDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A285DBS4/148-244          -SGILRLGELEIDHAQRRVRVRADDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0X3VWY8/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A3B7QI75/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1P8TFI1/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A170W9M5/148-244          -NGTLRLGELEIDHAQRRVRVRGEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
L7EQ27/148-244              -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
B5HKJ3/160-256              -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0L0K2V7/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A3Q9KUY9/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1C4S172/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A3S8WF18/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1Q5KZE0/149-245          -SGILRLGELEIDHAQRRVRVKAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPN-
A0A3N1I928/149-245          -SGILRLGELEIDHAQRRVRVKAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPN-
A0A2M9JPY9/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2Z2YID6/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0M4E3H8/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1W5YXX1/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
N0CYI7/148-244              -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1C6LNC3/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A2V2PSR2/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1C4MYD8/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1E7LU07/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A429USC1/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1C6M9Z0/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1Q4WHK5/149-244          -SGILRLGELEIDHAQRRVRVRGTDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETP--
A0A0N0T2U7/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A0T1S499/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A3N6EGN6/149-245          -SGILRFGELEIDHAQRRVRVHAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
V4KJB4/149-245              -SGILRFGELEIDHAQRRVRVHAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
I2N623/149-245              -SGILRLGELEIDHAQRRVRVRSDDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A3R9WLX5/148-245          -GSTLRLGDLEIDHAQRRVRVHAEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A497W4N9/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1V1YSA1/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2U0X877/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A498BM61/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2A3J774/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1I2J3H4/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2N3ZWH1/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A495CI94/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2C8XDJ3/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2G7C2S8/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A250VAT3/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2G7AIP0/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A372M6B3/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANSPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPN-
A0A2A2YME3/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A209BYI1/147-243          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
D6EUK3/147-243              -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A0N6ZHZ3/147-243          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A346C6F4/147-243          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A397QHH4/147-243          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2S6XCP6/147-243          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1R1WHE9/147-243          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1H2CWT6/147-243          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A3Q8VVA2/147-243          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A0N0YRK0/147-243          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A3E0GL96/147-243          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A209CJ52/147-243          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
H1QIB4/147-243              -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A3N1DRM9/147-243          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2P8A6R1/147-243          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A3B0BSU5/148-244          -SGILRLGELEIDHAQRRVRVRGADVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A3R9XQE4/148-244          -SGILRLGELEIDHAQRRVRVKGEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
C9ZA87/148-244              -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2A3H046/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1B6ACV0/169-265          -SGILRLGELEIDHAQRRVRVRGADVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALEAPA-
S4AQK2/149-245              -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1Z1WJ20/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
S5VMM0/149-245              -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A3N6HAN8/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
S2YU51/148-244              -SGILRLGELEIDHAQRRVRVHSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2T5ALK6/148-244          -SGILRLGELEIDHAQRRVRVHSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A0K2AYK5/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A345HU52/148-244          -SGILRLGELEIDHAQRRVRVRGEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1G8WLC6/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A0L8QHI4/91-187           -TGILRLGELEIDHAQRRVRVRGSDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1Q5MBW4/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1X4I750/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A327VUF7/148-244          -SGILRLGELEIDHAQRRVRVRNEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A0H4C4U9/149-245          -SGILRLGELEIDHAQRRVRVKSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A255PGZ8/149-245          -SGILRLGELEIDHAQRRVRVKSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0U5MDQ3/149-245          -SGILRLGELEIDHAQRRVRVKSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A2N3W1U1/148-244          -TGILRLGELEIDHAQRRVRVRGEDVHLTPTEFDLLSCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A197SPF5/148-244          -TGILRLGELEIDHAQRRVRVRGEDVHLTPTEFDLLSCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A059W7Y0/149-244          -SGILRLGELEIDHAQRRVRVRGSDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETP--
A0A2M9MFX0/149-244          -SGILRLGELEIDHAQRRVRVRGSDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETP--
A0A101QV64/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A176KUG1/148-244          -SGILRLGELEIDHAQRRVRVKSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
V6KDC6/148-244              -SGILRLGELEIDHAQRRVRVRGEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1B1AS72/149-245          -SGILRLGELEIDHAQRRVRVKSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A124F5I8/149-245          -SGILRLGELEIDHAQRRVRVRGNDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A2P2GIC4/147-243          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1D2IEA3/149-245          -SGILRLGELEIDHAQRRVRVHGEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAEHIRTVHGVGYALETPT-
D5ZXM7/149-245              -NGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2U3HBZ4/149-245          -NGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1M5XBC5/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2G7A040/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A081XPD1/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2K2RGW6/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A0J7ANI5/148-245          -GATLRLGDLEIDHAQRRVRVQAEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A3N1UY02/148-245          -GATLRLGDLEIDHAQRRVRVQAEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A397R8D3/148-245          -GATLRLGDLEIDHAQRRVRVQAEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A2G7CIM6/148-245          -GATLRLGDLEIDHAQRRVRVQAEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A0N0S5P6/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2P8PWK0/148-244          -SGILRLGELEIDHAQRRVRVRADDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A3R9VW82/148-245          -GATLRLGDLEIDHAQRRVRVQAEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGADRIRTVHGVGYALETPAQ
D9VYQ5/148-245              -GATLRLGDLEIDHAQRRVRVQAEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGADRIRTVHGVGYALETPAQ
A0A3S8YDS4/148-245          -GATLRLGDLEIDHAQRRVRVQAEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGADRIRTVHGVGYALETPAQ
A0A0Q8YNC7/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1Q5KUJ6/149-245          -SGILRLGELEIDHAQRRVRVKSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1V9KFC2/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
M3B9F5/148-244              -SGILRLGELEIDHAQRRVRVRGADVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0X3W916/149-244          -SGILRLGELEIDHAQRRVRVRGNDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETP--
A0A1B1MH20/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1G9PDQ2/150-246          -SGIMRLGELEIDHAQRRVRVRNEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A022MRH8/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1A9J1Y9/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A429N6F7/148-244          -SGVLRLGELEIDHAQRRVRVRSQDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1A5P778/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2S1SWX7/150-246          -SGILRLGELEIDHAQRRVRVRNEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0M9YXN5/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A177HTG4/150-246          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1D8G6E9/148-244          -SGILRLGELEIDHAQRRVRVRNDDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0F5VRS5/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1V4DP95/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2U2ZTK9/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A117P0F2/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A3N4V798/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1C6MPQ9/150-246          -SGTLRLGELEIDHAQRRVRVRGEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1Q4VF70/150-246          -SGTLRLGELEIDHAQRRVRVRGEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A0X3SF17/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A3D9QRT4/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2S4XX58/149-244          -SGILRLGELEIDHAQRRVRVRGADVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETP--
A0A101NAI3/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A3R8STP4/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2S4YR90/148-244          -TGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2K8PCM4/148-245          -GATLRLGDLEIDHAQRRVRVQAEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A3L8JZL6/148-244          -TGILRLGELEIDHAQRRVRVRGTDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A370BCF5/148-244          -SGILRLGELEIDHAQRRVRVRGEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1H4TS11/149-245          -SGILRLGELEIDHAQRRVRVRGSDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A3R9V896/149-245          -SGILRLGELEIDHAQRRVRVRGSDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0J8BSK0/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A101U4X0/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1H0DDB2/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A0C1XHR5/148-244          -SGILRLGELEIDHAQRRVRVRGEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0U3G4E0/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2R4JG03/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1V9WH04/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A0T1TPY3/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2G7F5W5/148-244          -SGILRLGELEIDHAQRRVRVHSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1Q4ZL88/148-244          -SGILRLGELEIDHAQRRVRVRTEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A117RDN8/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A101UJ35/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
Q82J12/148-244              -TGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1S2KDT1/148-244          -SGILRLGELEIDHAQRRVRVRNDDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHVKALRRKIGAERIRTVHGVGYALETPA-
A0A0B5DGZ4/148-244          -SGSLRLGELEIDHAQRRVRVRGEDVHLTPTEFDLLVCLASTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
G2G523/148-244              -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A117RXD1/148-244          -SGILRLGELEIDHAQRRVRVRSDDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1J4NXC8/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1S2NX13/148-244          -SGMLRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A2N5XJN2/146-243          ASASLHLGDLEIDHAQRRVRVRGEDVHLTPTEFDLLVCLAQTPRAVLSREQLLAEVWDWADASGTRTVDSHVKALRRKIGAERIRTVHGVGYALETPV-
A0A1Q5N2D3/148-245          -GATLRLGDLEIDHAQRRVRVQTEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPAQ
A0A160P5P6/148-244          -SGILRLGELEIDHAQRRVRVRADDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1G5GH42/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1A9CP97/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1X2N0S4/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1L6PGU2/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A2T7LT45/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A2P8BAY6/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A2T7KHT5/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A212QYG2/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1C5EYD6/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
W9FV01/148-244              -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A2T7M2N8/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1C4RKG1/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A2M9LKL4/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1Q5HGB0/148-243          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETP--
A0A1C5F0N7/148-244          -SGILRLGELEIDHAQRRVRVRGEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A2S9Q0H7/150-246          -SGILRLGELEVDHAQRRVRVRGEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
K4R2A6/148-244              -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1H9MYZ7/148-244          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
D7CHE5/149-245              -SGILRLGELEIDHAQRRVRVRGVDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
S3C094/152-248              -SGTLRLGELEIDHAQRRVRVSGEDVHLTPTEFDLLVCLAHSPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPG-
A0A0N1KBC3/152-248          -SGTLRLGELEIDHAQRRVRVSGEDVHLTPTEFDLLVCLAHSPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPG-
A0A429T9T9/148-245          -GATLRLGDLEIDHAQRRVRVQAEDVHLTPTEFDLLVCLAGTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGADRIRTVHGVGYALETPAQ
A0A3M0IFW5/149-245          -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A101SUZ3/148-244          -SGILRLGELEIDHAQRRVRVKAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1D7Y9F9/149-245          -SGILRLGELEIDHAQRRVRVKSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A0S1UIS6/128-224          -SGILRLGELEIDHAQRRVRVHAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A423V3P2/148-244          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A0M3QI94/160-256          -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
X0NHP2/149-244              -SGILRLGELEIDHAQRRVRVRGSDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETP--
A0A0B5EWC3/149-245          -SGILRLGELEIDHSQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
A0A1Y2NQH3/148-244          -SGILRLGELEIDHAQRRVRVRNDDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
A0A1V4ACS5/149-245          -AGILRLGELEIDHAQRRVRVRGEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
L8PJK4/148-244              -SGILRLGELEIDHAQRRVRVRSEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPT-
D6AML7/148-244              -SGILRLGELEIDHAQRRVRVRAEDVHLTPTEFDLLVCLANTPRAVLSREQLLAEVWDWADASGTRTVDSHIKALRRKIGAERIRTVHGVGYALETPA-
#=GC scorecons              067688897988998999999647989999999999899968999999999999999999999999999998999999999889999999998998950
#=GC scorecons_70           _*********************_*****************_********************************************************__
#=GC scorecons_80           ____*****************___****************_********************************************************__
#=GC scorecons_90           ____****_************___****************_********************************************************__
//