# STOCKHOLM 1.0
#=GF ID 4.10.640.10/FF/1440
#=GF DE 30S ribosomal protein S18
#=GF AC 4.10.640.10/FF/1440
#=GF TP FunFam
#=GF DR CATH: 4.2
#=GF DR DOPS: 63.673
#=GS Q73GZ6/7-91       AC Q73GZ6
#=GS Q73GZ6/7-91       OS Wolbachia endosymbiont of Drosophila melanogaster
#=GS Q73GZ6/7-91       DE 30S ribosomal protein S18
#=GS Q73GZ6/7-91       DR GENE3D; 3dcb812d8f445f555dacbed69a160038/7-91; 
#=GS Q73GZ6/7-91       DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Wolbachieae; Wolbachia; Wolbachia endosymbiont of Drosophila melanogaster; 
#=GS Q2GLH5/22-96      AC Q2GLH5
#=GS Q2GLH5/22-96      OS Anaplasma phagocytophilum str. HZ
#=GS Q2GLH5/22-96      DE 30S ribosomal protein S18
#=GS Q2GLH5/22-96      DR GENE3D; 54a7da1ffc89da1d6cd3a5a91e0a161b/22-96; 
#=GS Q2GLH5/22-96      DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Anaplasma; phagocytophilum group; Anaplasma phagocytophilum; 
#=GS Q5FG28/19-95      AC Q5FG28
#=GS Q5FG28/19-95      OS Ehrlichia ruminantium str. Gardel
#=GS Q5FG28/19-95      DE 30S ribosomal protein S18
#=GS Q5FG28/19-95      DR GENE3D; 1297addb307d1d133da59536b59f3375/19-95; 
#=GS Q5FG28/19-95      DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Ehrlichia; canis group; Ehrlichia ruminantium; 
#=GS Q5HAJ5/19-95      AC Q5HAJ5
#=GS Q5HAJ5/19-95      OS Ehrlichia ruminantium str. Welgevonden
#=GS Q5HAJ5/19-95      DE 30S ribosomal protein S18
#=GS Q5HAJ5/19-95      DR GENE3D; 1297addb307d1d133da59536b59f3375/19-95; 
#=GS Q5HAJ5/19-95      DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Ehrlichia; canis group; Ehrlichia ruminantium; 
#=GS A0A170S379/19-95  AC A0A170S379
#=GS A0A170S379/19-95  OS Ehrlichia ruminantium
#=GS A0A170S379/19-95  DE 30S ribosomal protein S18
#=GS A0A170S379/19-95  DR GENE3D; 1297addb307d1d133da59536b59f3375/19-95; 
#=GS A0A170S379/19-95  DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Ehrlichia; canis group; Ehrlichia ruminantium; 
#=GS B9KHP6/26-100     AC B9KHP6
#=GS B9KHP6/26-100     OS Anaplasma marginale str. Florida
#=GS B9KHP6/26-100     DE 30S ribosomal protein S18
#=GS B9KHP6/26-100     DR GENE3D; 161a443a1c395ac4fc8816ba6e39bb50/26-100; 
#=GS B9KHP6/26-100     DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Anaplasma; Anaplasma marginale; 
#=GS Q2GHF3/19-95      AC Q2GHF3
#=GS Q2GHF3/19-95      OS Ehrlichia chaffeensis str. Arkansas
#=GS Q2GHF3/19-95      DE 30S ribosomal protein S18
#=GS Q2GHF3/19-95      DR GENE3D; 1a4c9f22b62c059e5e55c78d2d3c4e3d/19-95; 
#=GS Q2GHF3/19-95      DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Ehrlichia; canis group; Ehrlichia chaffeensis; 
#=GS Q4EC23/7-91       AC Q4EC23
#=GS Q4EC23/7-91       OS Wolbachia endosymbiont of Drosophila ananassae
#=GS Q4EC23/7-91       DE 30S ribosomal protein S18
#=GS Q4EC23/7-91       DR GENE3D; 3dcb812d8f445f555dacbed69a160038/7-91; 
#=GS Q4EC23/7-91       DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Wolbachieae; Wolbachia; Wolbachia endosymbiont of Drosophila ananassae; 
#=GS C0R3A3/7-91       AC C0R3A3
#=GS C0R3A3/7-91       OS Wolbachia sp. wRi
#=GS C0R3A3/7-91       DE 30S ribosomal protein S18
#=GS C0R3A3/7-91       DR GENE3D; 3dcb812d8f445f555dacbed69a160038/7-91; 
#=GS C0R3A3/7-91       DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Wolbachieae; Wolbachia; Wolbachia sp. wRi; 
#=GS A0A1D8MLB3/7-91   AC A0A1D8MLB3
#=GS A0A1D8MLB3/7-91   OS Wolbachia endosymbiont of Drosophila incompta
#=GS A0A1D8MLB3/7-91   DE 30S ribosomal protein S18
#=GS A0A1D8MLB3/7-91   DR GENE3D; 3dcb812d8f445f555dacbed69a160038/7-91; 
#=GS A0A1D8MLB3/7-91   DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Wolbachieae; Wolbachia; Wolbachia endosymbiont of Drosophila incompta; 
#=GS M9WUQ5/7-91       AC M9WUQ5
#=GS M9WUQ5/7-91       OS Wolbachia endosymbiont of Drosophila simulans wHa
#=GS M9WUQ5/7-91       DE 30S ribosomal protein S18
#=GS M9WUQ5/7-91       DR GENE3D; 3dcb812d8f445f555dacbed69a160038/7-91; 
#=GS M9WUQ5/7-91       DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Wolbachieae; Wolbachia; Wolbachia endosymbiont of Drosophila simulans; 
#=GS A0A098ASZ2/7-91   AC A0A098ASZ2
#=GS A0A098ASZ2/7-91   OS Wolbachia
#=GS A0A098ASZ2/7-91   DE 30S ribosomal protein S18
#=GS A0A098ASZ2/7-91   DR GENE3D; 3dcb812d8f445f555dacbed69a160038/7-91; 
#=GS A0A098ASZ2/7-91   DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Wolbachieae; Wolbachia; 
#=GS Q5GSD5/6-91       AC Q5GSD5
#=GS Q5GSD5/6-91       OS Wolbachia endosymbiont strain TRS of Brugia malayi
#=GS Q5GSD5/6-91       DE 30S ribosomal protein S18
#=GS Q5GSD5/6-91       DR GENE3D; 47fb91c4aae77c7239fa4726c9a4c53f/6-91; 
#=GS Q5GSD5/6-91       DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Wolbachieae; Wolbachia; Wolbachia endosymbiont of Brugia malayi; 
#=GS Q5PBN0/3-75       AC Q5PBN0
#=GS Q5PBN0/3-75       OS Anaplasma marginale str. St. Maries
#=GS Q5PBN0/3-75       DE 30S ribosomal protein S18
#=GS Q5PBN0/3-75       DR GENE3D; 4ad76e7800c7bdbf4c6b536af366b132/3-75; 
#=GS Q5PBN0/3-75       DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Anaplasma; Anaplasma marginale; 
#=GS A0A0F3NKW1/22-96  AC A0A0F3NKW1
#=GS A0A0F3NKW1/22-96  OS Anaplasma phagocytophilum str. NCH-1
#=GS A0A0F3NKW1/22-96  DE 30S ribosomal protein S18
#=GS A0A0F3NKW1/22-96  DR GENE3D; 54a7da1ffc89da1d6cd3a5a91e0a161b/22-96; 
#=GS A0A0F3NKW1/22-96  DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Anaplasma; phagocytophilum group; Anaplasma phagocytophilum; 
#=GS A0A0F3NGT8/22-96  AC A0A0F3NGT8
#=GS A0A0F3NGT8/22-96  OS Anaplasma phagocytophilum str. ApNP
#=GS A0A0F3NGT8/22-96  DE 30S ribosomal protein S18
#=GS A0A0F3NGT8/22-96  DR GENE3D; 54a7da1ffc89da1d6cd3a5a91e0a161b/22-96; 
#=GS A0A0F3NGT8/22-96  DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Anaplasma; phagocytophilum group; Anaplasma phagocytophilum; 
#=GS S5Q1G7/22-96      AC S5Q1G7
#=GS S5Q1G7/22-96      OS Anaplasma phagocytophilum str. JM
#=GS S5Q1G7/22-96      DE 30S ribosomal protein S18
#=GS S5Q1G7/22-96      DR GENE3D; 54a7da1ffc89da1d6cd3a5a91e0a161b/22-96; 
#=GS S5Q1G7/22-96      DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Anaplasma; phagocytophilum group; Anaplasma phagocytophilum; 
#=GS A0A168H3L6/22-96  AC A0A168H3L6
#=GS A0A168H3L6/22-96  OS Anaplasma phagocytophilum str. Norway variant2
#=GS A0A168H3L6/22-96  DE 30S ribosomal protein S18
#=GS A0A168H3L6/22-96  DR GENE3D; 54a7da1ffc89da1d6cd3a5a91e0a161b/22-96; 
#=GS A0A168H3L6/22-96  DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Anaplasma; phagocytophilum group; Anaplasma phagocytophilum; 
#=GS A0A098EFA7/22-96  AC A0A098EFA7
#=GS A0A098EFA7/22-96  OS Anaplasma phagocytophilum
#=GS A0A098EFA7/22-96  DE 30S ribosomal protein S18
#=GS A0A098EFA7/22-96  DR GENE3D; 54a7da1ffc89da1d6cd3a5a91e0a161b/22-96; 
#=GS A0A098EFA7/22-96  DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Anaplasma; phagocytophilum group; Anaplasma phagocytophilum; 
#=GS A0A0A1XZ75/22-96  AC A0A0A1XZ75
#=GS A0A0A1XZ75/22-96  OS Anaplasma phagocytophilum str. MRK
#=GS A0A0A1XZ75/22-96  DE 30S ribosomal protein S18
#=GS A0A0A1XZ75/22-96  DR GENE3D; 54a7da1ffc89da1d6cd3a5a91e0a161b/22-96; 
#=GS A0A0A1XZ75/22-96  DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Anaplasma; phagocytophilum group; Anaplasma phagocytophilum; 
#=GS A0A0F3Q724/22-96  AC A0A0F3Q724
#=GS A0A0F3Q724/22-96  OS Anaplasma phagocytophilum str. CRT53-1
#=GS A0A0F3Q724/22-96  DE 30S ribosomal protein S18
#=GS A0A0F3Q724/22-96  DR GENE3D; 54a7da1ffc89da1d6cd3a5a91e0a161b/22-96; 
#=GS A0A0F3Q724/22-96  DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Anaplasma; phagocytophilum group; Anaplasma phagocytophilum; 
#=GS A0A0F3N9T2/22-96  AC A0A0F3N9T2
#=GS A0A0F3N9T2/22-96  OS Anaplasma phagocytophilum str. ApMUC09
#=GS A0A0F3N9T2/22-96  DE 30S ribosomal protein S18
#=GS A0A0F3N9T2/22-96  DR GENE3D; 54a7da1ffc89da1d6cd3a5a91e0a161b/22-96; 
#=GS A0A0F3N9T2/22-96  DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Anaplasma; phagocytophilum group; Anaplasma phagocytophilum; 
#=GS A0A0F3Q027/22-96  AC A0A0F3Q027
#=GS A0A0F3Q027/22-96  OS Anaplasma phagocytophilum str. ApWI1
#=GS A0A0F3Q027/22-96  DE 30S ribosomal protein S18
#=GS A0A0F3Q027/22-96  DR GENE3D; 54a7da1ffc89da1d6cd3a5a91e0a161b/22-96; 
#=GS A0A0F3Q027/22-96  DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Anaplasma; phagocytophilum group; Anaplasma phagocytophilum; 
#=GS I7IAI0/8-91       AC I7IAI0
#=GS I7IAI0/8-91       OS Wolbachia endosymbiont of Onchocerca ochengi
#=GS I7IAI0/8-91       DE 30S ribosomal protein S18
#=GS I7IAI0/8-91       DR GENE3D; 9f6e506bac29fb18dd0b0ed4edc3a14c/8-91; 
#=GS I7IAI0/8-91       DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Wolbachieae; Wolbachia; Wolbachia endosymbiont of Onchocerca ochengi; 
#=GS A0A1E7QKC5/2-88   AC A0A1E7QKC5
#=GS A0A1E7QKC5/2-88   OS Wolbachia pipientis
#=GS A0A1E7QKC5/2-88   DE 30S ribosomal protein S18
#=GS A0A1E7QKC5/2-88   DR GENE3D; b3acd29fda2dff2a450573fb8224e235/2-88; 
#=GS A0A1E7QKC5/2-88   DR ORG; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Anaplasmataceae; Wolbachieae; Wolbachia; Wolbachia pipientis; 
#=GF TC 153.8 4.1E-49
#=GF SQ 25
Q73GZ6/7-91               --SFNNSYVSVNNRTGFRRSKVCPLAASKDEDIDYKNIDLLSKFTSDYGRILPRRLTGVCAKKQRKLRLAIIRARFLALIPYCTKKV
Q2GLH5/22-96              --------LVYLKRPYFRKSRSCPLAQCPDEDIDYKNKVLLSKFVSEYGRILPSRITSVSARKQKLLARAIKRARYLALLPYC----
Q5FG28/19-95              ------SPLAYLKRPYFRRSKACPLEQCANEDIDYKNKALLSKFTSEYGRILPSRITSVSSRKQRLLSTAIKRARYLALLPYC----
Q5HAJ5/19-95              ------SPLAYLKRPYFRRSKACPLEQCANEDIDYKNKALLSKFTSEYGRILPSRITSVSSRKQRLLSTAIKRARYLALLPYC----
A0A170S379/19-95          ------SPLAYLKRPYFRRSKACPLEQCANEDIDYKNKALLSKFTSEYGRILPSRITSVSSRKQRLLSTAIKRARYLALLPYC----
B9KHP6/26-100             --------LVYLKRPYFRKSRSCPLAQCPDEDIDYKNRALLSKFVSEYGRILPSRITSVSSRKQKLLARAVKRARFLALLPYC----
Q2GHF3/19-95              ------SPLAYLKRPYFKRSKACPLEQCPNEDIDYKNKGLLSKFTSEYGRILPSRITSVSSRKQRLLSTAVKRARYLALLPYC----
Q4EC23/7-91               --SFNNSYVSVNNRTGFRRSKVCPLAASKDEDIDYKNIDLLSKFTSDYGRILPRRLTGVCAKKQRKLRLAIIRARFLALIPYCTKKV
C0R3A3/7-91               --SFNNSYVSVNNRTGFRRSKVCPLAASKDEDIDYKNIDLLSKFTSDYGRILPRRLTGVCAKKQRKLRLAIIRARFLALIPYCTKKV
A0A1D8MLB3/7-91           --SFNNSYVSVNNRTGFRRSKVCPLAASKDEDIDYKNIDLLSKFTSDYGRILPRRLTGVCAKKQRKLRLAIIRARFLALIPYCTKKV
M9WUQ5/7-91               --SFNNSYVSVNNRTGFRRSKVCPLAASKDEDIDYKNIDLLSKFTSDYGRILPRRLTGVCAKKQRKLRLAIIRARFLALIPYCTKKV
A0A098ASZ2/7-91           --SFNNSYVSVNNRTGFRRSKVCPLAASKDEDIDYKNIDLLSKFTSDYGRILPRRLTGVCAKKQRKLRLAIIRARFLALIPYCTKKV
Q5GSD5/6-91               -NNFNDSYVSVNNRTGFKRSKVCPLATSQDEDIDYKNTDLLSRFTSDYGRILPRRLTGVCAKKQRKLRLAIIRARFLALVPYCTKKV
Q5PBN0/3-75               ----------YLKRPYFRKSRSCPLAQCPDEDIDYKNRALLSKFVSEYGRILPSRITSVSSRKQKLLARAVKRARFLALLPYC----
A0A0F3NKW1/22-96          --------LVYLKRPYFRKSRSCPLAQCPDEDIDYKNKVLLSKFVSEYGRILPSRITSVSARKQKLLARAIKRARYLALLPYC----
A0A0F3NGT8/22-96          --------LVYLKRPYFRKSRSCPLAQCPDEDIDYKNKVLLSKFVSEYGRILPSRITSVSARKQKLLARAIKRARYLALLPYC----
S5Q1G7/22-96              --------LVYLKRPYFRKSRSCPLAQCPDEDIDYKNKVLLSKFVSEYGRILPSRITSVSARKQKLLARAIKRARYLALLPYC----
A0A168H3L6/22-96          --------LVYLKRPYFRKSRSCPLAQCPDEDIDYKNKVLLSKFVSEYGRILPSRITSVSARKQKLLARAIKRARYLALLPYC----
A0A098EFA7/22-96          --------LVYLKRPYFRKSRSCPLAQCPDEDIDYKNKVLLSKFVSEYGRILPSRITSVSARKQKLLARAIKRARYLALLPYC----
A0A0A1XZ75/22-96          --------LVYLKRPYFRKSRSCPLAQCPDEDIDYKNKVLLSKFVSEYGRILPSRITSVSARKQKLLARAIKRARYLALLPYC----
A0A0F3Q724/22-96          --------LVYLKRPYFRKSRSCPLAQCPDEDIDYKNKVLLSKFVSEYGRILPSRITSVSARKQKLLARAIKRARYLALLPYC----
A0A0F3N9T2/22-96          --------LVYLKRPYFRKSRSCPLAQCPDEDIDYKNKVLLSKFVSEYGRILPSRITSVSARKQKLLARAIKRARYLALLPYC----
A0A0F3Q027/22-96          --------LVYLKRPYFRKSRSCPLAQCPDEDIDYKNKVLLSKFVSEYGRILPSRITSVSARKQKLLARAIKRARYLALLPYC----
I7IAI0/8-91               ---FNDSYLSMNNRTGFRRSKACPLATSKDEDIDYKNTDLLSKFTSDYGRILPRRLTGVCARRQRKLRLAIIRARFLALVPYCTKKA
A0A1E7QKC5/2-88           MRKRNNSYAYVSNKTGYRRSKVCPLEKYTREDIDYKNKELLSKFTSDYGRILPRRLTGVSAKKQRMLRLAIIRARFLALVSYCTKKV
#=GC scorecons            000111325444686488797499965547999999944999896979999995969696778974944984999799968991111
#=GC scorecons_70         _____________*__*****_****___********__*****_********_***_*******_*__**_*******_***____
#=GC scorecons_80         _____________*__*****_***_____*******__*****_*_******_*_*_*___***_*__**_*******_***____
#=GC scorecons_90         _____________*__**_*__***_____*******__*****_*_******_*_*_*___**__*__**_***_***_***____
//