# STOCKHOLM 1.0 #=GF ID 3.30.40.10/FF/45691 #=GF DE ORF61 #=GF AC 3.30.40.10/FF/45691 #=GF TP FunFam #=GF DR CATH: 4.2 #=GF DR DOPS: 0.000 #=GS Q71S71/13-79 AC Q71S71 #=GS Q71S71/13-79 OS Human herpesvirus 3 VZV-32 #=GS Q71S71/13-79 DE ORF61 #=GS Q71S71/13-79 DR GENE3D; 0f9ada215099d877d766529564ef458b/13-79; #=GS Q71S71/13-79 DR ORG; Viruses; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Varicellovirus; Human alphaherpesvirus 3; #=GS Q71S71/13-79 DR EC; 2.3.2.27; #=GS Q6QCJ5/13-79 AC Q6QCJ5 #=GS Q6QCJ5/13-79 OS Human alphaherpesvirus 3 #=GS Q6QCJ5/13-79 DE Modulator of cell state and gene expression #=GS Q6QCJ5/13-79 DR GENE3D; 0f9ada215099d877d766529564ef458b/13-79; #=GS Q6QCJ5/13-79 DR ORG; Viruses; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Varicellovirus; Human alphaherpesvirus 3; #=GS Q6QCJ5/13-79 DR EC; 2.3.2.27; #=GS P09309/13-79 AC P09309 #=GS P09309/13-79 OS Human herpesvirus 3 strain Dumas #=GS P09309/13-79 DE E3 ubiquitin-protein ligase IE61 #=GS P09309/13-79 DR GENE3D; 0f9ada215099d877d766529564ef458b/13-79; #=GS P09309/13-79 DR ORG; Viruses; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Varicellovirus; Human alphaherpesvirus 3; #=GS P09309/13-79 DR EC; 2.3.2.27; #=GS Q77NN8/13-79 AC Q77NN8 #=GS Q77NN8/13-79 OS Human herpesvirus 3 strain Oka vaccine #=GS Q77NN8/13-79 DE ORF61 #=GS Q77NN8/13-79 DR GENE3D; 0f9ada215099d877d766529564ef458b/13-79; #=GS Q77NN8/13-79 DR ORG; Viruses; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Varicellovirus; Human alphaherpesvirus 3; #=GS Q77NN8/13-79 DR EC; 2.3.2.27; #=GF TC 172.6 5.4E-56 #=GF SQ 4 Q71S71/13-79 DASDNTCTICMSTVSDLGKTMPCLHDFCFVCIRAWTSTSVQCPLCRCPVQSILHKIVSDTSYKEYEV Q6QCJ5/13-79 DASDNTCTICMSTVSDLGKTMPCLHDFCFVCIRAWTSTSVQCPLCRCPVQSILHKIVSDTSYKEYEV P09309/13-79 DASDNTCTICMSTVSDLGKTMPCLHDFCFVCIRAWTSTSVQCPLCRCPVQSILHKIVSDTSYKEYEV Q77NN8/13-79 DASDNTCTICMSTVSDLGKTMPCLHDFCFVCIRAWTSTSVQCPLCRCPVQSILHKIVSDTSYKEYEV #=GC scorecons 0000000000000000000000000000000000000000000000000000000000000000000 #=GC scorecons_70 ___________________________________________________________________ #=GC scorecons_80 ___________________________________________________________________ #=GC scorecons_90 ___________________________________________________________________ //