# STOCKHOLM 1.0 #=GF ID 3.30.40.10/FF/24745 #=GF DE Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 #=GF AC 3.30.40.10/FF/24745 #=GF TP FunFam #=GF DR CATH: 4.2 #=GF DR DOPS: 9.020 #=GS Q9FNI6/789-843 AC Q9FNI6 #=GS Q9FNI6/789-843 OS Arabidopsis thaliana #=GS Q9FNI6/789-843 DE Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 #=GS Q9FNI6/789-843 DR GENE3D; f59156668d99dac8beb095bce2888b52/789-843; #=GS Q9FNI6/789-843 DR ORG; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; rosids; Brassicales; Brassicaceae; Camelineae; Arabidopsis; Arabidopsis thaliana; #=GS Q9FNI6/789-843 DR GO; GO:0000724; GO:0009294; GO:0045003; #=GS M4CQZ3/787-841 AC M4CQZ3 #=GS M4CQZ3/787-841 OS Brassica rapa subsp. pekinensis #=GS M4CQZ3/787-841 DE Uncharacterized protein #=GS M4CQZ3/787-841 DR GENE3D; 7fc36b66e3783b9a5009f43fe0d2ddce/787-841; #=GS M4CQZ3/787-841 DR ORG; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; rosids; Brassicales; Brassicaceae; Brassiceae; Brassica; Brassica rapa; Brassica rapa subsp. pekinensis; #=GS D7M1I1/789-843 AC D7M1I1 #=GS D7M1I1/789-843 OS Arabidopsis lyrata subsp. lyrata #=GS D7M1I1/789-843 DE Putative uncharacterized protein #=GS D7M1I1/789-843 DR GENE3D; abae77855540ebc99d66f08bf6251046/789-843; #=GS D7M1I1/789-843 DR ORG; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; rosids; Brassicales; Brassicaceae; Camelineae; Arabidopsis; Arabidopsis lyrata; Arabidopsis lyrata subsp. lyrata; #=GF TC 141.4 1.1E-45 #=GF SQ 3 Q9FNI6/789-843 GEQGECPICLEALEDAVLTPCAHRLCRECLLASWRNSTSGLCPVCRNTVSKQELI M4CQZ3/787-841 GEQGECPICLEAFEDAVLTPCAHRLCRECLLASWRNSSSGLCPVCRKTVSKQELI D7M1I1/789-843 GEQGECPICLEAFEDAVLTPCAHRLCRECLLASWRNSNTGLCPVCRKTVSKQELI #=GC scorecons 9999999999995999999999999999999999999359999999599999999 #=GC scorecons_70 ************_************************__*******_******** #=GC scorecons_80 ************_************************__*******_******** #=GC scorecons_90 ************_************************__*******_******** //