# STOCKHOLM 1.0
#=GF ID 1.10.10.10/FF/87092
#=GF DE GntR family transcriptional regulator
#=GF AC 1.10.10.10/FF/87092
#=GF TP FunFam
#=GF DR CATH: 4.2
#=GF DR DOPS: 25.503
#=GS Q9K492/21-87      AC Q9K492
#=GS Q9K492/21-87      OS Streptomyces coelicolor A3(2)
#=GS Q9K492/21-87      DE HTH-type transcriptional repressor DasR
#=GS Q9K492/21-87      DR GENE3D; 91a64f2f1a71f0fda02e0613999f0e62/21-87; 
#=GS Q9K492/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces coelicolor; 
#=GS A0A1D7VSY0/10-84  AC A0A1D7VSY0
#=GS A0A1D7VSY0/10-84  OS Streptomyces lydicus
#=GS A0A1D7VSY0/10-84  DE GntR family transcriptional regulator
#=GS A0A1D7VSY0/10-84  DR GENE3D; c788e5c20d2d3fa4bafa3a69b45517bb/10-84; 
#=GS A0A1D7VSY0/10-84  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces lydicus; 
#=GS A0A1J7B321/21-87  AC A0A1J7B321
#=GS A0A1J7B321/21-87  OS Streptomyces pluripotens
#=GS A0A1J7B321/21-87  DE GntR family transcriptional regulator
#=GS A0A1J7B321/21-87  DR GENE3D; dc974e3645f227a4961d65d209ff2052/21-87; 
#=GS A0A1J7B321/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces pluripotens; 
#=GS L1L3M8/21-87      AC L1L3M8
#=GS L1L3M8/21-87      OS Streptomyces ipomoeae 91-03
#=GS L1L3M8/21-87      DE UbiC transcription regulator-associated
#=GS L1L3M8/21-87      DR GENE3D; eb0f30ebc2a8b282a2657047e96ea3dc/21-87; 
#=GS L1L3M8/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces ipomoeae; 
#=GS I2N5X0/21-87      AC I2N5X0
#=GS I2N5X0/21-87      OS Streptomyces tsukubensis NRRL18488
#=GS I2N5X0/21-87      DE GntR family transcriptional regulator
#=GS I2N5X0/21-87      DR GENE3D; bf392516421012c572e613d8daff58a6/21-87; 
#=GS I2N5X0/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces tsukubensis; 
#=GS D6EUQ7/21-87      AC D6EUQ7
#=GS D6EUQ7/21-87      OS Streptomyces lividans TK24
#=GS D6EUQ7/21-87      DE HTH-type transcriptional repressor DasR
#=GS D6EUQ7/21-87      DR GENE3D; 91a64f2f1a71f0fda02e0613999f0e62/21-87; 
#=GS D6EUQ7/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces lividans; 
#=GS A0A0N6W580/21-87  AC A0A0N6W580
#=GS A0A0N6W580/21-87  OS Streptomyces sp. CCM_MD2014
#=GS A0A0N6W580/21-87  DE GntR family transcriptional regulator
#=GS A0A0N6W580/21-87  DR GENE3D; 91a64f2f1a71f0fda02e0613999f0e62/21-87; 
#=GS A0A0N6W580/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. CCM_MD2014; 
#=GS A0A0N0YR84/21-87  AC A0A0N0YR84
#=GS A0A0N0YR84/21-87  OS Streptomyces sp. NRRL WC-3753
#=GS A0A0N0YR84/21-87  DE GntR family transcriptional regulator
#=GS A0A0N0YR84/21-87  DR GENE3D; 91a64f2f1a71f0fda02e0613999f0e62/21-87; 
#=GS A0A0N0YR84/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL WC-3753; 
#=GS A0A1H2CV74/21-87  AC A0A1H2CV74
#=GS A0A1H2CV74/21-87  OS Streptomyces sp. 2114.2
#=GS A0A1H2CV74/21-87  DE Transcriptional regulator, GntR family
#=GS A0A1H2CV74/21-87  DR GENE3D; 91a64f2f1a71f0fda02e0613999f0e62/21-87; 
#=GS A0A1H2CV74/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 2114.2; 
#=GS H1QI50/21-87      AC H1QI50
#=GS H1QI50/21-87      OS Streptomyces coelicoflavus ZG0656
#=GS H1QI50/21-87      DE GntR family transcriptional regulator
#=GS H1QI50/21-87      DR GENE3D; 91a64f2f1a71f0fda02e0613999f0e62/21-87; 
#=GS H1QI50/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces coelicoflavus; 
#=GS A0A0M8Z628/21-87  AC A0A0M8Z628
#=GS A0A0M8Z628/21-87  OS Streptomyces sp. NRRL F-7442
#=GS A0A0M8Z628/21-87  DE GntR family transcriptional regulator
#=GS A0A0M8Z628/21-87  DR GENE3D; 91a64f2f1a71f0fda02e0613999f0e62/21-87; 
#=GS A0A0M8Z628/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL F-7442; 
#=GS A0A0C1W332/21-87  AC A0A0C1W332
#=GS A0A0C1W332/21-87  OS Streptomyces sp. RSD-27
#=GS A0A0C1W332/21-87  DE GntR family transcriptional regulator
#=GS A0A0C1W332/21-87  DR GENE3D; b65c0b7c961aa738aa976bc161ea4c0c/21-87; 
#=GS A0A0C1W332/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. RSD-27; 
#=GS B1W186/21-87      AC B1W186
#=GS B1W186/21-87      OS Streptomyces griseus subsp. griseus NBRC 13350
#=GS B1W186/21-87      DE GntR-family transcriptional regulator
#=GS B1W186/21-87      DR GENE3D; d21e90179df1876bb2af3f3edc826357/21-87; 
#=GS B1W186/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseus group; Streptomyces griseus; Streptomyces griseus subsp. griseus; 
#=GS G0Q8Z4/21-87      AC G0Q8Z4
#=GS G0Q8Z4/21-87      OS Streptomyces sp. ACT-1
#=GS G0Q8Z4/21-87      DE Transcriptional regulator, GntR family with UTRA sensor domain
#=GS G0Q8Z4/21-87      DR GENE3D; d21e90179df1876bb2af3f3edc826357/21-87; 
#=GS G0Q8Z4/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. ACT-1; 
#=GS A0A1A9CCR7/21-87  AC A0A1A9CCR7
#=GS A0A1A9CCR7/21-87  OS Streptomyces sp. MnatMP-M77
#=GS A0A1A9CCR7/21-87  DE Transcriptional regulator, GntR family
#=GS A0A1A9CCR7/21-87  DR GENE3D; d21e90179df1876bb2af3f3edc826357/21-87; 
#=GS A0A1A9CCR7/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. MnatMP-M77; 
#=GS A0A1C4KSL0/21-87  AC A0A1C4KSL0
#=GS A0A1C4KSL0/21-87  OS Streptomyces sp. OspMP-M43
#=GS A0A1C4KSL0/21-87  DE Transcriptional regulator, GntR family
#=GS A0A1C4KSL0/21-87  DR GENE3D; d21e90179df1876bb2af3f3edc826357/21-87; 
#=GS A0A1C4KSL0/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. OspMP-M43; 
#=GS V6KK62/21-87      AC V6KK62
#=GS V6KK62/21-87      OS Streptomyces niveus NCIMB 11891
#=GS V6KK62/21-87      DE GntR family transcriptional regulator
#=GS V6KK62/21-87      DR GENE3D; f7556807bb1861b0cda9cd891a3b3b38/21-87; 
#=GS V6KK62/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces niveus; 
#=GS A0A086MY13/21-87  AC A0A086MY13
#=GS A0A086MY13/21-87  OS Streptomyces luteus
#=GS A0A086MY13/21-87  DE GntR family transcriptional regulator
#=GS A0A086MY13/21-87  DR GENE3D; 0d9808f1ee4b1164c0c591eba979e7b3/21-87; 
#=GS A0A086MY13/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces luteus; 
#=GS V6KKX8/21-87      AC V6KKX8
#=GS V6KKX8/21-87      OS Streptomyces roseochromogenus subsp. oscitans DS 12.976
#=GS V6KKX8/21-87      DE GntR family transcriptional regulator
#=GS V6KKX8/21-87      DR GENE3D; b7fe3ec5f3dc85b7f61fce5794d02a9a/21-87; 
#=GS V6KKX8/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces roseochromogenus; Streptomyces roseochromogenus subsp. oscitans; 
#=GS A0A0A8EKU0/20-86  AC A0A0A8EKU0
#=GS A0A0A8EKU0/20-86  OS Streptomyces sp. 769
#=GS A0A0A8EKU0/20-86  DE Putative transcriptional regulator of N-Acetylglucosamine utilization C GntR family
#=GS A0A0A8EKU0/20-86  DR GENE3D; 6984e8be8ef0f302aa5088bc746e8e84/20-86; 
#=GS A0A0A8EKU0/20-86  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 769; 
#=GS H2K264/20-86      AC H2K264
#=GS H2K264/20-86      OS Streptomyces hygroscopicus subsp. jinggangensis 5008
#=GS H2K264/20-86      DE GntR-family transcriptional regulator
#=GS H2K264/20-86      DR GENE3D; 146bc99de6a26b0299bd5fa24458f685/20-86; 
#=GS H2K264/20-86      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces hygroscopicus; Streptomyces hygroscopicus subsp. jinggangensis; 
#=GS A0A101PM48/20-86  AC A0A101PM48
#=GS A0A101PM48/20-86  OS Streptomyces corchorusii
#=GS A0A101PM48/20-86  DE GntR family transcriptional regulator
#=GS A0A101PM48/20-86  DR GENE3D; 146bc99de6a26b0299bd5fa24458f685/20-86; 
#=GS A0A101PM48/20-86  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces corchorusii; 
#=GS J1S9Z3/18-84      AC J1S9Z3
#=GS J1S9Z3/18-84      OS Streptomyces auratus AGR0001
#=GS J1S9Z3/18-84      DE GntR family transcriptional regulator
#=GS J1S9Z3/18-84      DR GENE3D; 8d7642d959db356fafc3e792b0459995/18-84; 
#=GS J1S9Z3/18-84      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces auratus; 
#=GS B4V958/21-87      AC B4V958
#=GS B4V958/21-87      OS Streptomyces sp. Mg1
#=GS B4V958/21-87      DE GntR family transcriptional regulator
#=GS B4V958/21-87      DR GENE3D; b1155c2c54851cc8b547b8de3846d107/21-87; 
#=GS B4V958/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Mg1; 
#=GS F3NMX5/21-87      AC F3NMX5
#=GS F3NMX5/21-87      OS Streptomyces griseoaurantiacus M045
#=GS F3NMX5/21-87      DE GntR family transcriptional regulator
#=GS F3NMX5/21-87      DR GENE3D; 932c64648550426598440f82a27528ca/21-87; 
#=GS F3NMX5/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseoaurantiacus; 
#=GS D6K0I4/21-87      AC D6K0I4
#=GS D6K0I4/21-87      OS Streptomyces sp. e14
#=GS D6K0I4/21-87      DE HTH-type transcriptional repressor DasR
#=GS D6K0I4/21-87      DR GENE3D; 03cf176deaf08ecb7fb372bef133ff24/21-87; 
#=GS D6K0I4/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. e14; 
#=GS B5HB77/21-87      AC B5HB77
#=GS B5HB77/21-87      OS Streptomyces pristinaespiralis ATCC 25486
#=GS B5HB77/21-87      DE HTH-type transcriptional repressor dasR
#=GS B5HB77/21-87      DR GENE3D; 607289c527ce63459bd097bfa50967ce/21-87; 
#=GS B5HB77/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces pristinaespiralis; 
#=GS A0A1J0UVP2/21-87  AC A0A1J0UVP2
#=GS A0A1J0UVP2/21-87  OS Streptomyces venezuelae
#=GS A0A1J0UVP2/21-87  DE GntR family transcriptional regulator
#=GS A0A1J0UVP2/21-87  DR GENE3D; 8181196756623052763bd5d957bbdf45/21-87; 
#=GS A0A1J0UVP2/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces venezuelae; 
#=GS F2R2Q7/21-87      AC F2R2Q7
#=GS F2R2Q7/21-87      OS Streptomyces venezuelae ATCC 10712
#=GS F2R2Q7/21-87      DE Predicted transcriptional regulator of N-Acetylglucosamine utilization, GntR family
#=GS F2R2Q7/21-87      DR GENE3D; 8181196756623052763bd5d957bbdf45/21-87; 
#=GS F2R2Q7/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces venezuelae; 
#=GS F8K533/46-112     AC F8K533
#=GS F8K533/46-112     OS Streptomyces cattleya NRRL 8057 = DSM 46488
#=GS F8K533/46-112     DE Putative gntR family transcriptional regulator
#=GS F8K533/46-112     DR GENE3D; 4ed06cc98321806a5bc9fb22fba6dee5/46-112; 
#=GS F8K533/46-112     DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces cattleya; 
#=GS G2P1Y4/31-97      AC G2P1Y4
#=GS G2P1Y4/31-97      OS Streptomyces violaceusniger Tu 4113
#=GS G2P1Y4/31-97      DE Transcriptional regulator, GntR family with UTRA sensor domain
#=GS G2P1Y4/31-97      DR GENE3D; 394b009007e03f2e5600b45c9bfd255e/31-97; 
#=GS G2P1Y4/31-97      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces violaceusniger; 
#=GS D9XNQ1/21-87      AC D9XNQ1
#=GS D9XNQ1/21-87      OS Streptomyces griseoflavus Tu4000
#=GS D9XNQ1/21-87      DE HTH-type transcriptional repressor DasR
#=GS D9XNQ1/21-87      DR GENE3D; 5a37899aebc0a3fcff57c0cc5639dae6/21-87; 
#=GS D9XNQ1/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseoflavus; 
#=GS A0A059WDC0/20-86  AC A0A059WDC0
#=GS A0A059WDC0/20-86  OS Streptomyces albulus
#=GS A0A059WDC0/20-86  DE GntR family transcriptional regulator
#=GS A0A059WDC0/20-86  DR GENE3D; 41b7dcf1dd257f0f0026bc4f84a8244e/20-86; 
#=GS A0A059WDC0/20-86  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albulus; 
#=GS X0P1I8/20-86      AC X0P1I8
#=GS X0P1I8/20-86      OS Streptomyces albulus PD-1
#=GS X0P1I8/20-86      DE GntR family transcriptional regulator
#=GS X0P1I8/20-86      DR GENE3D; 41b7dcf1dd257f0f0026bc4f84a8244e/20-86; 
#=GS X0P1I8/20-86      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albulus; 
#=GS A0A0C1XPA4/21-87  AC A0A0C1XPA4
#=GS A0A0C1XPA4/21-87  OS Streptomyces sp. 150FB
#=GS A0A0C1XPA4/21-87  DE GntR family transcriptional regulator
#=GS A0A0C1XPA4/21-87  DR GENE3D; 1ed6c54d74ebf07ba16819978cce372a/21-87; 
#=GS A0A0C1XPA4/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 150FB; 
#=GS E8WCT4/21-87      AC E8WCT4
#=GS E8WCT4/21-87      OS Streptomyces pratensis ATCC 33331
#=GS E8WCT4/21-87      DE Transcriptional regulator, GntR family
#=GS E8WCT4/21-87      DR GENE3D; 8886cb184646f5b44d2973be20c8e513/21-87; 
#=GS E8WCT4/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces pratensis; 
#=GS M9TY60/21-87      AC M9TY60
#=GS M9TY60/21-87      OS Streptomyces sp. PAMC 26508
#=GS M9TY60/21-87      DE Putative transcriptional regulator of N-Acetylglucosamine utilization
#=GS M9TY60/21-87      DR GENE3D; 8886cb184646f5b44d2973be20c8e513/21-87; 
#=GS M9TY60/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. PAMC 26508; 
#=GS S3ZBA4/55-121     AC S3ZBA4
#=GS S3ZBA4/55-121     OS Streptomyces aurantiacus JA 4570
#=GS S3ZBA4/55-121     DE Putative HTH-type transcriptional repressor DasR
#=GS S3ZBA4/55-121     DR GENE3D; 4620ff2281e4c4d710a8a39c761c434d/55-121; 
#=GS S3ZBA4/55-121     DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces aurantiacus; 
#=GS K4R2E3/21-87      AC K4R2E3
#=GS K4R2E3/21-87      OS Streptomyces davawensis JCM 4913
#=GS K4R2E3/21-87      DE HTH-type transcriptional repressor dasR
#=GS K4R2E3/21-87      DR GENE3D; 165ba22a68bff7004c5e0221a40926ad/21-87; 
#=GS K4R2E3/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces davawensis; 
#=GS A0A081XLZ4/21-87  AC A0A081XLZ4
#=GS A0A081XLZ4/21-87  OS Streptomyces toyocaensis
#=GS A0A081XLZ4/21-87  DE GntR family transcriptional regulator
#=GS A0A081XLZ4/21-87  DR GENE3D; add89aa4d84a86496f5da565fedeb0b6/21-87; 
#=GS A0A081XLZ4/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces toyocaensis; 
#=GS S2XYW7/21-87      AC S2XYW7
#=GS S2XYW7/21-87      OS Streptomyces sp. HGB0020
#=GS S2XYW7/21-87      DE HTH-type transcriptional repressor dasR
#=GS S2XYW7/21-87      DR GENE3D; 2efb326e0f3b2f008ebb3e24de92017b/21-87; 
#=GS S2XYW7/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. HGB0020; 
#=GS A0A0B5EUS6/29-95  AC A0A0B5EUS6
#=GS A0A0B5EUS6/29-95  OS Streptomyces albus subsp. albus DSM 41398
#=GS A0A0B5EUS6/29-95  DE GntR family transcriptional regulator
#=GS A0A0B5EUS6/29-95  DR GENE3D; b27e97e68262b7eeedbe393930ad6eb5/29-95; 
#=GS A0A0B5EUS6/29-95  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus group; Streptomyces albus; Streptomyces albus subsp. albus; 
#=GS Q8VV01/20-86      AC Q8VV01
#=GS Q8VV01/20-86      OS Streptomyces griseus
#=GS Q8VV01/20-86      DE HTH-type transcriptional repressor DasR
#=GS Q8VV01/20-86      DR GENE3D; bd30a235aaa46fd8bdbca776c9a05cca/20-86; 
#=GS Q8VV01/20-86      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseus group; Streptomyces griseus; 
#=GS A0A0U3QBV7/21-87  AC A0A0U3QBV7
#=GS A0A0U3QBV7/21-87  OS Streptomyces sp. 4F
#=GS A0A0U3QBV7/21-87  DE GntR family transcriptional regulator
#=GS A0A0U3QBV7/21-87  DR GENE3D; 7534aec481ff5b7abfa080593eed6d85/21-87; 
#=GS A0A0U3QBV7/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. 4F; 
#=GS A0A072SB59/21-87  AC A0A072SB59
#=GS A0A072SB59/21-87  OS Streptomyces griseorubens
#=GS A0A072SB59/21-87  DE GntR family transcriptional regulator
#=GS A0A072SB59/21-87  DR GENE3D; 7534aec481ff5b7abfa080593eed6d85/21-87; 
#=GS A0A072SB59/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseorubens; 
#=GS D5ZYU6/21-87      AC D5ZYU6
#=GS D5ZYU6/21-87      OS Streptomyces ghanaensis ATCC 14672
#=GS D5ZYU6/21-87      DE GntR-family transcriptional regulator
#=GS D5ZYU6/21-87      DR GENE3D; 64b8b65f1b4c88522829663fe7d9a145/21-87; 
#=GS D5ZYU6/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces ghanaensis; 
#=GS D9WGC9/24-90      AC D9WGC9
#=GS D9WGC9/24-90      OS Streptomyces himastatinicus ATCC 53653
#=GS D9WGC9/24-90      DE Transcriptional regulator, GntR-family
#=GS D9WGC9/24-90      DR GENE3D; 242dd973d17b6b56fd4678edfbc8042c/24-90; 
#=GS D9WGC9/24-90      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces himastatinicus; 
#=GS A0A0B5DPP9/21-87  AC A0A0B5DPP9
#=GS A0A0B5DPP9/21-87  OS Streptomyces nodosus
#=GS A0A0B5DPP9/21-87  DE GntR family transcriptional regulator
#=GS A0A0B5DPP9/21-87  DR GENE3D; ead9f331da0780dce44f3c25c2b9fd7c/21-87; 
#=GS A0A0B5DPP9/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces nodosus; 
#=GS A0A089Z3S3/21-87  AC A0A089Z3S3
#=GS A0A089Z3S3/21-87  OS Streptomyces glaucescens
#=GS A0A089Z3S3/21-87  DE Putative HTH-type transcriptional repressor DasR
#=GS A0A089Z3S3/21-87  DR GENE3D; f87ba4b0e1a08c22fc52518d823c08b8/21-87; 
#=GS A0A089Z3S3/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces glaucescens; 
#=GS A0A1A9J0K0/21-87  AC A0A1A9J0K0
#=GS A0A1A9J0K0/21-87  OS Streptomyces sp. SAT1
#=GS A0A1A9J0K0/21-87  DE GntR family transcriptional regulator
#=GS A0A1A9J0K0/21-87  DR GENE3D; 70c883e5fd28f0181ea18f7fd55f1045/21-87; 
#=GS A0A1A9J0K0/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. SAT1; 
#=GS A0A022MNP6/21-87  AC A0A022MNP6
#=GS A0A022MNP6/21-87  OS Streptomyces sp. Tu 6176
#=GS A0A022MNP6/21-87  DE GntR family transcriptional regulator
#=GS A0A022MNP6/21-87  DR GENE3D; 70c883e5fd28f0181ea18f7fd55f1045/21-87; 
#=GS A0A022MNP6/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Tu 6176; 
#=GS S5VV20/21-87      AC S5VV20
#=GS S5VV20/21-87      OS Streptomyces collinus Tu 365
#=GS S5VV20/21-87      DE GntR family transcriptional regulator
#=GS S5VV20/21-87      DR GENE3D; 85a1ba8b448ea8b4d36fda9d71948b33/21-87; 
#=GS S5VV20/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces collinus; 
#=GS A0A1C5C1I7/21-87  AC A0A1C5C1I7
#=GS A0A1C5C1I7/21-87  OS Streptomyces sp. Ncost-T6T-2b
#=GS A0A1C5C1I7/21-87  DE Transcriptional regulator, GntR family
#=GS A0A1C5C1I7/21-87  DR GENE3D; 15d54584f141fb579c7867ede5dec080/21-87; 
#=GS A0A1C5C1I7/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ncost-T6T-2b; 
#=GS A0A1C4TRP5/21-87  AC A0A1C4TRP5
#=GS A0A1C4TRP5/21-87  OS Streptomyces sp. Termitarium-T10T-6
#=GS A0A1C4TRP5/21-87  DE Transcriptional regulator, GntR family
#=GS A0A1C4TRP5/21-87  DR GENE3D; 15d54584f141fb579c7867ede5dec080/21-87; 
#=GS A0A1C4TRP5/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Termitarium-T10T-6; 
#=GS W9FV94/21-87      AC W9FV94
#=GS W9FV94/21-87      OS Streptomyces roseosporus NRRL 11379
#=GS W9FV94/21-87      DE Histidine utilization repressor
#=GS W9FV94/21-87      DR GENE3D; 15d54584f141fb579c7867ede5dec080/21-87; 
#=GS W9FV94/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces filamentosus; 
#=GS A0A1L6PGZ9/21-87  AC A0A1L6PGZ9
#=GS A0A1L6PGZ9/21-87  OS Streptomyces sp. Tue 6075
#=GS A0A1L6PGZ9/21-87  DE GntR family transcriptional regulator
#=GS A0A1L6PGZ9/21-87  DR GENE3D; 15d54584f141fb579c7867ede5dec080/21-87; 
#=GS A0A1L6PGZ9/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Tue 6075; 
#=GS A0A1C5D3J5/21-87  AC A0A1C5D3J5
#=GS A0A1C5D3J5/21-87  OS Streptomyces sp. Cmuel-A718b
#=GS A0A1C5D3J5/21-87  DE Transcriptional regulator, GntR family
#=GS A0A1C5D3J5/21-87  DR GENE3D; 15d54584f141fb579c7867ede5dec080/21-87; 
#=GS A0A1C5D3J5/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Cmuel-A718b; 
#=GS A0A1B9ELK9/21-87  AC A0A1B9ELK9
#=GS A0A1B9ELK9/21-87  OS Streptomyces sp. PTY087I2
#=GS A0A1B9ELK9/21-87  DE HTH-type transcriptional repressor DasR
#=GS A0A1B9ELK9/21-87  DR GENE3D; 15d54584f141fb579c7867ede5dec080/21-87; 
#=GS A0A1B9ELK9/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. PTY087I2; 
#=GS A0A1A9DDK3/21-87  AC A0A1A9DDK3
#=GS A0A1A9DDK3/21-87  OS Streptomyces sp. Ncost-T6T-1
#=GS A0A1A9DDK3/21-87  DE Transcriptional regulator, GntR family
#=GS A0A1A9DDK3/21-87  DR GENE3D; 15d54584f141fb579c7867ede5dec080/21-87; 
#=GS A0A1A9DDK3/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. Ncost-T6T-1; 
#=GS A0A0U3MI22/21-87  AC A0A0U3MI22
#=GS A0A0U3MI22/21-87  OS Streptomyces globisporus C-1027
#=GS A0A0U3MI22/21-87  DE GntR family transcriptional regulator
#=GS A0A0U3MI22/21-87  DR GENE3D; 15d54584f141fb579c7867ede5dec080/21-87; 
#=GS A0A0U3MI22/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces griseus group; Streptomyces globisporus; 
#=GS V6UQN8/21-87      AC V6UQN8
#=GS V6UQN8/21-87      OS Streptomyces sp. HCCB10043
#=GS V6UQN8/21-87      DE GntR family transcriptional regulator
#=GS V6UQN8/21-87      DR GENE3D; 15d54584f141fb579c7867ede5dec080/21-87; 
#=GS V6UQN8/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. HCCB10043; 
#=GS D6AMF8/21-87      AC D6AMF8
#=GS D6AMF8/21-87      OS Streptomyces roseosporus NRRL 15998
#=GS D6AMF8/21-87      DE HTH-type transcriptional repressor dasR
#=GS D6AMF8/21-87      DR GENE3D; 15d54584f141fb579c7867ede5dec080/21-87; 
#=GS D6AMF8/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces filamentosus; 
#=GS D9XEH3/21-87      AC D9XEH3
#=GS D9XEH3/21-87      OS Streptomyces viridochromogenes DSM 40736
#=GS D9XEH3/21-87      DE Histidine utilization repressor
#=GS D9XEH3/21-87      DR GENE3D; f3c5cf1e6e4996b281ac1eef2520f4f3/21-87; 
#=GS D9XEH3/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces viridochromogenes; 
#=GS G2G4Y1/21-87      AC G2G4Y1
#=GS G2G4Y1/21-87      OS Streptomyces zinciresistens K42
#=GS G2G4Y1/21-87      DE GntR family transcriptional regulator
#=GS G2G4Y1/21-87      DR GENE3D; 254d969a532dc919075b5f4a4911c54e/21-87; 
#=GS G2G4Y1/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces zinciresistens; 
#=GS S4NGN8/21-87      AC S4NGN8
#=GS S4NGN8/21-87      OS Streptomyces afghaniensis 772
#=GS S4NGN8/21-87      DE Putative HTH-type transcriptional repressor DasR
#=GS S4NGN8/21-87      DR GENE3D; 1e47f4de9ed12a3606177d8a6f6e9dd3/21-87; 
#=GS S4NGN8/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces afghaniensis; 
#=GS C9ZAD1/21-87      AC C9ZAD1
#=GS C9ZAD1/21-87      OS Streptomyces scabiei 87.22
#=GS C9ZAD1/21-87      DE Putative gntR-family transcriptional regulator
#=GS C9ZAD1/21-87      DR GENE3D; 0b21762404082dbceaa0b73e3022a3f3/21-87; 
#=GS C9ZAD1/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces scabiei; 
#=GS A0A0L0JP06/21-87  AC A0A0L0JP06
#=GS A0A0L0JP06/21-87  OS Streptomyces stelliscabiei
#=GS A0A0L0JP06/21-87  DE GntR family transcriptional regulator
#=GS A0A0L0JP06/21-87  DR GENE3D; 0b21762404082dbceaa0b73e3022a3f3/21-87; 
#=GS A0A0L0JP06/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces stelliscabiei; 
#=GS M3FN74/21-87      AC M3FN74
#=GS M3FN74/21-87      OS Streptomyces bottropensis ATCC 25435
#=GS M3FN74/21-87      DE DasR protein
#=GS M3FN74/21-87      DR GENE3D; 0b21762404082dbceaa0b73e3022a3f3/21-87; 
#=GS M3FN74/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces bottropensis; 
#=GS A0A0N1KCJ0/31-97  AC A0A0N1KCJ0
#=GS A0A0N1KCJ0/31-97  OS Streptomyces sp. NRRL F-6602
#=GS A0A0N1KCJ0/31-97  DE GntR family transcriptional regulator
#=GS A0A0N1KCJ0/31-97  DR GENE3D; 75d8fdb02802b4d1d6e9b1fb6b7f66c2/31-97; 
#=GS A0A0N1KCJ0/31-97  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. NRRL F-6602; 
#=GS S3B4S6/31-97      AC S3B4S6
#=GS S3B4S6/31-97      OS Streptomyces sp. HPH0547
#=GS S3B4S6/31-97      DE HTH-type transcriptional repressor dasR
#=GS S3B4S6/31-97      DR GENE3D; 75d8fdb02802b4d1d6e9b1fb6b7f66c2/31-97; 
#=GS S3B4S6/31-97      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. HPH0547; 
#=GS L7F7M7/17-83      AC L7F7M7
#=GS L7F7M7/17-83      OS Streptomyces turgidiscabies Car8
#=GS L7F7M7/17-83      DE UbiC transcription regulator-associated
#=GS L7F7M7/17-83      DR GENE3D; 150b323ce55357ea14d677aa8c792b67/17-83; 
#=GS L7F7M7/17-83      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces turgidiscabies; 
#=GS Q82IW0/21-87      AC Q82IW0
#=GS Q82IW0/21-87      OS Streptomyces avermitilis MA-4680 = NBRC 14893
#=GS Q82IW0/21-87      DE HTH-type transcriptional repressor DasR
#=GS Q82IW0/21-87      DR GENE3D; e7b8c6925ad1ecb5fb44a639ae679b6b/21-87; 
#=GS Q82IW0/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces avermitilis; 
#=GS G2NM20/21-87      AC G2NM20
#=GS G2NM20/21-87      OS Streptomyces sp. SirexAA-E
#=GS G2NM20/21-87      DE Transcriptional regulator, GntR family
#=GS G2NM20/21-87      DR GENE3D; 6bdd1f08e516948298ea93c9725ae360/21-87; 
#=GS G2NM20/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. SirexAA-E; 
#=GS A0A1C6Y5L7/21-87  AC A0A1C6Y5L7
#=GS A0A1C6Y5L7/21-87  OS Streptomyces sp. DpondAA-F4
#=GS A0A1C6Y5L7/21-87  DE Transcriptional regulator, GntR family
#=GS A0A1C6Y5L7/21-87  DR GENE3D; 6bdd1f08e516948298ea93c9725ae360/21-87; 
#=GS A0A1C6Y5L7/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. DpondAA-F4; 
#=GS A0A1C4JRY9/21-87  AC A0A1C4JRY9
#=GS A0A1C4JRY9/21-87  OS Streptomyces sp. DpondAA-F4a
#=GS A0A1C4JRY9/21-87  DE Transcriptional regulator, GntR family
#=GS A0A1C4JRY9/21-87  DR GENE3D; 6bdd1f08e516948298ea93c9725ae360/21-87; 
#=GS A0A1C4JRY9/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. DpondAA-F4a; 
#=GS A0A1C4HX21/21-87  AC A0A1C4HX21
#=GS A0A1C4HX21/21-87  OS Streptomyces sp. BpilaLS-43
#=GS A0A1C4HX21/21-87  DE Transcriptional regulator, GntR family
#=GS A0A1C4HX21/21-87  DR GENE3D; 6bdd1f08e516948298ea93c9725ae360/21-87; 
#=GS A0A1C4HX21/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. BpilaLS-43; 
#=GS A0A0C2AG86/21-87  AC A0A0C2AG86
#=GS A0A0C2AG86/21-87  OS Streptomyces sp. AcH 505
#=GS A0A0C2AG86/21-87  DE GntR family transcriptional regulator
#=GS A0A0C2AG86/21-87  DR GENE3D; d75a79807da61420088730835e818c3e/21-87; 
#=GS A0A0C2AG86/21-87  DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. AcH 505; 
#=GS D9VYJ4/21-87      AC D9VYJ4
#=GS D9VYJ4/21-87      OS Streptomyces sp. C
#=GS D9VYJ4/21-87      DE Histidine utilization repressor
#=GS D9VYJ4/21-87      DR GENE3D; 1ed5f3540a6ec633fdf1f6eecd6cd422/21-87; 
#=GS D9VYJ4/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sp. C; 
#=GS E2Q5F4/45-111     AC E2Q5F4
#=GS E2Q5F4/45-111     OS Streptomyces clavuligerus ATCC 27064
#=GS E2Q5F4/45-111     DE HTH-type transcriptional repressor dasR
#=GS E2Q5F4/45-111     DR GENE3D; f6bbd488386bdbaea22d17769011dde6/45-111; 
#=GS E2Q5F4/45-111     DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces clavuligerus; 
#=GS B5HN21/21-87      AC B5HN21
#=GS B5HN21/21-87      OS Streptomyces sviceus ATCC 29083
#=GS B5HN21/21-87      DE Histidine utilization repressor
#=GS B5HN21/21-87      DR GENE3D; f86d31a427cc0978b0472562638bb653/21-87; 
#=GS B5HN21/21-87      DR ORG; Bacteria; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces sviceus; 
#=GF TC 161.1 1.6E-50
#=GF SQ 80
Q9K492/21-87              ---------VPKYYRLKKHLLDMTRTQTPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A1D7VSY0/10-84          SGSGARTARVPKYYRLKRHLLEITDTLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAK-
A0A1J7B321/21-87          ---------VPKYYRLKKHLLDMTETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
L1L3M8/21-87              ---------VPKYYRLKKHLLDMTETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
I2N5X0/21-87              ---------VPKYYRLKRHLLDMTETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
D6EUQ7/21-87              ---------VPKYYRLKKHLLDMTRTQTPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A0N6W580/21-87          ---------VPKYYRLKKHLLDMTRTQTPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A0N0YR84/21-87          ---------VPKYYRLKKHLLDMTRTQTPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A1H2CV74/21-87          ---------VPKYYRLKKHLLDMTRTQTPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
H1QI50/21-87              ---------VPKYYRLKKHLLDMTRTQTPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A0M8Z628/21-87          ---------VPKYYRLKKHLLDMTRTQTPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A0C1W332/21-87          ---------VPKYYRLKRHLLDMTETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
B1W186/21-87              ---------VPKYYRLKRHLLDMTDTLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
G0Q8Z4/21-87              ---------VPKYYRLKRHLLDMTDTLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A1A9CCR7/21-87          ---------VPKYYRLKRHLLDMTDTLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A1C4KSL0/21-87          ---------VPKYYRLKRHLLDMTDTLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
V6KK62/21-87              ---------VPKYYRLKRHLLDMTETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A086MY13/21-87          ---------VPKYYHLKKHLLDMTRTQAPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
V6KKX8/21-87              ---------VPKYYRLKKHLLDMTETQAPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A0A8EKU0/20-86          ---------VPKYYRLKRHLLEITETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
H2K264/20-86              ---------VPKYYRLKKHLLDMTETQAPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A101PM48/20-86          ---------VPKYYRLKKHLLDMTETQAPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
J1S9Z3/18-84              ---------VPKYYRLKRHLLEITETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
B4V958/21-87              ---------VPKYYRLKRHLLDMTETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
F3NMX5/21-87              ---------VPKYYRLKKHLLDMTRTLPPGTPVPPERTLASEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
D6K0I4/21-87              ---------VPKYYRLKKHLLDMTQTQAPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
B5HB77/21-87              ---------VPKYYRLKRHLLDMTETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A1J0UVP2/21-87          ---------VPKYYRLKRHLLDMTETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
F2R2Q7/21-87              ---------VPKYYRLKRHLLDMTETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
F8K533/46-112             ---------VPKYYRLKKHLLDITQTMPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
G2P1Y4/31-97              ---------VPKYYRLKRHLLDITETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
D9XNQ1/21-87              ---------VPKYYRLKKHLLDMTETAPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A059WDC0/20-86          ---------VPKYYRLKRHLLEITETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
X0P1I8/20-86              ---------VPKYYRLKRHLLEITETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A0C1XPA4/21-87          ---------VPKYYRLKRHLLDMTETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
E8WCT4/21-87              ---------VPKYYRLKRHLLDMTDTMPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
M9TY60/21-87              ---------VPKYYRLKRHLLDMTDTMPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
S3ZBA4/55-121             ---------VPKYYRLKRHLLDMTETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
K4R2E3/21-87              ---------VPKYYRLKKHLLDMTETQAPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A081XLZ4/21-87          ---------VPKYYRLKKHLLDMTETAPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
S2XYW7/21-87              ---------VPKYYRLKKHLLDMTETQSPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A0B5EUS6/29-95          ---------VPKYYRLKRHLLDMTETMPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
Q8VV01/20-86              ---------VPKYYRLKRHLLDMTDTLPPGTPVPPERTLAAEFDTSRTTVPQALQELVVEGRLERIQGKGTFVAKP
A0A0U3QBV7/21-87          ---------VPKYYRLKKHLLDMTETAPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A072SB59/21-87          ---------VPKYYRLKKHLLDMTETAPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
D5ZYU6/21-87              ---------VPKYYRLKKHLLDMTETAPPGTSVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
D9WGC9/24-90              ---------VPKYYRLKRHLLEMTETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A0B5DPP9/21-87          ---------VPKYYRLKKHLLEMTETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A089Z3S3/21-87          ---------VPKYYRLKKHLLDMTETQAPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A1A9J0K0/21-87          ---------VPKYYRLKKHLLDMTQTQAPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A022MNP6/21-87          ---------VPKYYRLKKHLLDMTQTQAPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
S5VV20/21-87              ---------VPKYYRLKKHLLDMTETQAPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A1C5C1I7/21-87          ---------VPKYYRLKRHLLDMTDTLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A1C4TRP5/21-87          ---------VPKYYRLKRHLLDMTDTLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
W9FV94/21-87              ---------VPKYYRLKRHLLDMTDTLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A1L6PGZ9/21-87          ---------VPKYYRLKRHLLDMTDTLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A1C5D3J5/21-87          ---------VPKYYRLKRHLLDMTDTLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A1B9ELK9/21-87          ---------VPKYYRLKRHLLDMTDTLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A1A9DDK3/21-87          ---------VPKYYRLKRHLLDMTDTLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A0U3MI22/21-87          ---------VPKYYRLKRHLLDMTDTLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
V6UQN8/21-87              ---------VPKYYRLKRHLLDMTDTLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
D6AMF8/21-87              ---------VPKYYRLKRHLLDMTDTLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
D9XEH3/21-87              ---------VPKYYRLKKHLLDMTDTQAPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
G2G4Y1/21-87              ---------VPKYYRLKKHLLDMTETQAPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
S4NGN8/21-87              ---------VPKYYRLKKHLLDMTETQAPGTPVPPERTLATEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
C9ZAD1/21-87              ---------VPKYYRLKKHLLDMTETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A0L0JP06/21-87          ---------VPKYYRLKKHLLDMTETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
M3FN74/21-87              ---------VPKYYRLKKHLLDMTETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A0N1KCJ0/31-97          ---------VPKYYRLKRHLLEMTETLPPGTPVPPERTLASEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
S3B4S6/31-97              ---------VPKYYRLKRHLLEMTETLPPGTPVPPERTLASEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
L7F7M7/17-83              ---------VPKYYRLKKHLLDMTETQAPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
Q82IW0/21-87              ---------VPKYYRLKKHLLDMTETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
G2NM20/21-87              ---------VPKYYRLKRHLLDMTDTMPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A1C6Y5L7/21-87          ---------VPKYYRLKRHLLDMTDTMPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A1C4JRY9/21-87          ---------VPKYYRLKRHLLDMTDTMPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A1C4HX21/21-87          ---------VPKYYRLKRHLLDMTDTMPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
A0A0C2AG86/21-87          ---------VPKYYRLKRHLLDMTETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
D9VYJ4/21-87              ---------VPKYYRLKRHLLDMTETLPPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
E2Q5F4/45-111             ---------VPKYYRLKRHLLDMTETMPPGTPVPPERTLASEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
B5HN21/21-87              ---------VPKYYRLKKHLLDMTETQSPGTPVPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVAKP
#=GC scorecons            0000000009999989979997795946999899999999899999999989999999999999999999999997
#=GC scorecons_70         _________***************_*__************************************************
#=GC scorecons_80         _________********_******_*__************************************************
#=GC scorecons_90         _________********_***__*_*__***********************************************_
//