PDB: 2gli XML data for PDB: 2gli

Molscript image for 2gli
2gli
PDB coordinates for PDB 2gli

PDB 2gli

CATH Domains (5)

Domain IDChain IDCATH codeImage
2gliA01 2gliA 3.30.160.60 Molscript image for 2gliA01
2gliA02 2gliA 3.30.160.60 Molscript image for 2gliA02
2gliA03 2gliA 3.30.160.60 Molscript image for 2gliA03
2gliA04 2gliA 3.30.160.60 Molscript image for 2gliA04
2gliA05 2gliA 3.30.160.60 Molscript image for 2gliA05

[top]
Chain: 2gliA

Chopping figure for chain 2gliA

[top]
Chain: 2gliC

Sorry the PDB chain 2gliC has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 2gliD

Sorry the PDB chain 2gliD has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 2gliA 

>pdb|2gliA
ETDCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKPHKCTFEGCRKSYS
RLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEKPYVCKLPGCTKRYTDPSSLRKHVKTVHG
BLAST against CATH

[top]
Chain: 2gliC

Sorry, we couldn't get FASTA sequence information for '2gliC'. Either the entity '2gliC' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 2gliD

Sorry, we couldn't get FASTA sequence information for '2gliD'. Either the entity '2gliD' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.