PDB: 1pvi XML data for PDB: 1pvi

Molscript image for 1pvi
1pvi
PDB coordinates for PDB 1pvi

PDB 1pvi

CATH Domains (2)

Domain IDChain IDCATH codeImage
1pviA00 1pviA 3.40.210.10 Molscript image for 1pviA00
1pviB00 1pviB 3.40.210.10 Molscript image for 1pviB00

[top]
Chain: 1pviA

Chopping figure for chain 1pviA

[top]
Chain: 1pviB

Chopping figure for chain 1pviB

[top]
Chain: 1pviC

Sorry the PDB chain 1pviC has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1pviD

Sorry the PDB chain 1pviD has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1pviA 

>pdb|1pviA
MSHPDLNKLLELWPHIQEYQDLALKHGINDIFQDNGGKLLQVLLITGLTVLPGREGNDAVDNAGQEYELKSINIDLTKGF
STHHHMNPVIIAKYRQVPWIFAIYRGIAIEAIYRLEPKDLEFYYDKWERKWYSDGHKDINNPKIPVKYVMEHGTKIY
BLAST against CATH

[top]
Chain: 1pviB 

>pdb|1pviB
MSHPDLNKLLELWPHIQEYQDLALKHGINDIFQDNGGKLLQVLLITGLTVLPGREGNDAVDNAGQEYELKSINIDLTKGF
STHHHMNPVIIAKYRQVPWIFAIYRGIAIEAIYRLEPKDLEFYYDKWERKWYSDGHKDINNPKIPVKYVMEHGTKIY
BLAST against CATH

[top]
Chain: 1pviC

Sorry, we couldn't get FASTA sequence information for '1pviC'. Either the entity '1pviC' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1pviD

Sorry, we couldn't get FASTA sequence information for '1pviD'. Either the entity '1pviD' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.