PDB: 1mey XML data for PDB: 1mey

Molscript image for 1mey
1mey
PDB coordinates for PDB 1mey

PDB 1mey

CATH Domains (7)

Domain IDChain IDCATH codeImage
1meyC01 1meyC 3.30.160.60 Molscript image for 1meyC01
1meyC02 1meyC 3.30.160.60 Molscript image for 1meyC02
1meyC03 1meyC 3.30.160.60 Molscript image for 1meyC03
1meyF01 1meyF 3.30.160.60 Molscript image for 1meyF01
1meyF02 1meyF 3.30.160.60 Molscript image for 1meyF02
1meyF03 1meyF 3.30.160.60 Molscript image for 1meyF03
1meyG00 1meyG 3.30.160.60 Molscript image for 1meyG00

[top]
Chain: 1meyA

Sorry the PDB chain 1meyA has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1meyB

Sorry the PDB chain 1meyB has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1meyC

Chopping figure for chain 1meyC

[top]
Chain: 1meyD

Sorry the PDB chain 1meyD has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1meyE

Sorry the PDB chain 1meyE has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1meyF

Chopping figure for chain 1meyF

[top]
Chain: 1meyG

Chopping figure for chain 1meyG

[top]
Chain: 1meyA

Sorry, we couldn't get FASTA sequence information for '1meyA'. Either the entity '1meyA' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1meyB

Sorry, we couldn't get FASTA sequence information for '1meyB'. Either the entity '1meyB' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1meyC 

>pdb|1meyC
MEKPYKCPECGKSFSQSSNLQKHQRTHTGEKPYKCPECGKSFSQSSDLQKHQRTHTGEKPYKCPECGKSFSRSDHLSRHQ
RTHQNKK
BLAST against CATH

[top]
Chain: 1meyD

Sorry, we couldn't get FASTA sequence information for '1meyD'. Either the entity '1meyD' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1meyE

Sorry, we couldn't get FASTA sequence information for '1meyE'. Either the entity '1meyE' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1meyF 

>pdb|1meyF
MEKPYKCPECGKSFSQSSNLQKHQRTHTGEKPYKCPECGKSFSQSSDLQKHQRTHTGEKPYKCPECGKSFSRSDHLSRHQ
RTHQNKK
BLAST against CATH

[top]
Chain: 1meyG 

>pdb|1meyG
TGEKPYKCPECGKSFSRSDHLSRHQRTHQNKK
BLAST against CATH