PDB: 1cjg XML data for PDB: 1cjg

Molscript image for 1cjg
1cjg
PDB coordinates for PDB 1cjg

PDB 1cjg

CATH Domains (2)

Domain IDChain IDCATH codeImage
1cjgA00 1cjgA 1.10.260.40 Molscript image for 1cjgA00
1cjgB00 1cjgB 1.10.260.40 Molscript image for 1cjgB00

[top]
Chain: 1cjgA

Chopping figure for chain 1cjgA

[top]
Chain: 1cjgB

Chopping figure for chain 1cjgB

[top]
Chain: 1cjgC

Sorry the PDB chain 1cjgC has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1cjgD

Sorry the PDB chain 1cjgD has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1cjgA 

>pdb|1cjgA
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSL
BLAST against CATH

[top]
Chain: 1cjgB 

>pdb|1cjgB
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSL
BLAST against CATH

[top]
Chain: 1cjgC

Sorry, we couldn't get FASTA sequence information for '1cjgC'. Either the entity '1cjgC' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1cjgD

Sorry, we couldn't get FASTA sequence information for '1cjgD'. Either the entity '1cjgD' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.