PDB: 1azq XML data for PDB: 1azq

Molscript image for 1azq
1azq
PDB coordinates for PDB 1azq

PDB 1azq

CATH Domains (1)

Domain IDChain IDCATH codeImage
1azqA00 1azqA 2.40.50.40 Molscript image for 1azqA00

[top]
Chain: 1azqA

Chopping figure for chain 1azqA

[top]
Chain: 1azqB

Sorry the PDB chain 1azqB has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1azqC

Sorry the PDB chain 1azqC has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1azqA 

>pdb|1azqA
MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
BLAST against CATH

[top]
Chain: 1azqB

Sorry, we couldn't get FASTA sequence information for '1azqB'. Either the entity '1azqB' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1azqC

Sorry, we couldn't get FASTA sequence information for '1azqC'. Either the entity '1azqC' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.