Set cath from cathlist by auto on 05 Mar 2006 18:29
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 7odcA01 | 2 | 47 |
| 7odcA01 | 280 | 418 |
| 7odcA02 | 48 | 279 |
There are 1 matching structural neighberhood comparisons for CATH ID 2.40.37.10.5.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1d7kB01 | 92.34 | 2.40.37.10 | 133 | 90 | 77 | 1.16 | 1.50 |
>pdb|7odcA01 SSFTKDEFDCHILDEGFTAKDILDQKINDKDAFYVADLGDVASAFTLAVNIIAKKTVWEQTFMYYVNDGVYGSFNCILYD HAHVKALLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVMSRP MWQLMK
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"