CATH Domain: 3ygsP00 XML data for domain: 3ygsP00

Molscript image for 3ygsP00
3ygsP00
PDB coordinates for domain 3ygsP00

PDB 3ygs, Chain P, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.533 Death Domain, Fas
1.10.533.10 Death Domain, Fas Gene3D
1.10.533.10.4
1.10.533.10.4.1
1.10.533.10.4.1.1
1.10.533.10.4.1.1.1
1.10.533.10.4.1.1.1.1

[top]
Segment boundaries for domain 3ygsP00

Chopping figure for domain 3ygsP00
DomainStart PDB ResidueStop PDB Residue
3ygsP00 1 97

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 1.10.533.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1dgnA00 85.03 Caspase recruitment domain-containing protein 18NOD-like receptor signaling pathwayCaspase recruitment domain-containing protein 18Homo sapiens 1.10.533.10 89 23 88 2.31 2.61
3ezqB00 83.87 FAS (TNFRSF6)-associated via death domainIdentical protein bindingPathways in cancerChagas diseaseAlzheimer's disease 1.10.533.10 99 10 88 2.82 3.17
1ucpA00 82.29 Protein homodimerization activityApoptosis-associated speck-like protein containing a CARDPositive regulation of interleukin-1 beta secretionPyrin domain bindingTumor necrosis factor-mediated signaling pathway 1.10.533.10 91 16 81 2.65 3.25
3crdA00 81.55 Death domain-containing protein CRADDDeath domain bindingProtease bindingProtein binding, bridgingHomo sapiens 1.10.533.10 100 22 92 2.91 3.16
1ichA00 80.31 Integral to plasma membraneChagas diseaseTumor necrosis factor receptor superfamily member 1AAlzheimer's diseasePositive regulation of I-kappaB kinase/NF-kappaB cascade 1.10.533.10 87 12 83 3.29 3.94
1a1wA00 80.26 FAS (TNFRSF6)-associated via death domainIdentical protein bindingPathways in cancerChagas diseaseAlzheimer's disease 1.10.533.10 83 12 78 2.36 3.01
1ngrA00 79.76 Negative regulation of muscle organ developmentRattus norvegicusNucleusNeurotrophin signaling pathwayTumor necrosis factor receptor superfamily member 16 1.10.533.10 85 14 86 3.56 4.11
1pn5A00 78.27 Protein domain specific bindingStreptococcus sp. 'group G'ATP bindingEnzyme bindingHomo sapiens 1.10.533.10 93 12 84 4.03 4.77
1n3kA00 76.12 Astrocytic phosphoprotein PEA-15Cricetulus griseus 1.10.533.10 130 11 61 2.58 4.19
[1]
Displaying entries 1 to 9 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3ygsP00
SMDEADRRLLRRCRLRLVEELQVDQLWDVLLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLED
TGQDMLASFLRTNRQAG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3ygsP00
SMDEADRRLLRRCRLRLVEELQVDQLWDVLLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLED
TGQDMLASFLRTNRQAG
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:13

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:13

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:34

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"