Set cath from cathlist by auto on 05 Mar 2006 19:24
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 3pmgA01 | 1 | 197 |
| 3pmgA02 | 198 | 300 |
| 3pmgA03 | 301 | 400 |
| 3pmgA04 | 401 | 561 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|3pmgA03 FFVNPSDSVAVIAANIFSIPYFQQTGVRGFARSMPTSGALDRVANATKIALYETPTGWKFFGNLMDASKLSLCGEESFGT GSDHIREKDGLWAVLAWLSI
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"