CATH Domain: 3nulA00 XML data for domain: 3nulA00

Molscript image for 3nulA00
3nulA00
PDB coordinates for domain 3nulA00

PDB 3nul, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.450 Beta-Lactamase
3.30.450.30 Dynein light chain 2a, cytoplasmic Gene3D
3.30.450.30.3
3.30.450.30.3.1
3.30.450.30.3.1.1
3.30.450.30.3.1.1.1
3.30.450.30.3.1.1.1.1

[top]
Segment boundaries for domain 3nulA00

Chopping figure for domain 3nulA00
DomainStart PDB ResidueStop PDB Residue
3nulA00 2 131

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.30.450.30.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3d9yA00 91.69 NucleusCytosolSchizosaccharomyces pombeGuanyl-nucleotide exchange factor activityActin cortical patch 3.30.450.30 126 36 97 1.85 1.90
1vetB00 81.88 Mus musculusActivation of MAPKK activityMitogen-activated protein-binding protein-interacting proteinProtein binding 3.30.450.30 118 14 83 3.47 4.16
1vetA00 80.35 Mus musculusKinase activator activityMitogen-activated protein kinase scaffold protein 1Activation of MAPKK activityMAPK signaling pathway 3.30.450.30 122 9 80 3.14 3.92
1ifqB00 77.54 SNARE interactions in vesicular transportMus musculusVesicle-trafficking protein SEC22bGolgi membraneEndoplasmic reticulum membrane 3.30.450.50 125 9 67 2.84 4.21
3kshA00 76.15 GAF domain-containing proteinStaphylococcus aureus subsp. aureus MRSA252Putative uncharacterized protein 3.30.450.40 152 0 65 2.98 4.58
2qybA00 75.85 Membrane protein, putativeGeobacter sulfurreducens 3.30.450.40 147 10 69 3.41 4.91
3eeaA00 75.19 GAF domain/HD domain proteinGeobacter sulfurreducens 3.30.450.40 153 6 66 3.22 4.83
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3nulA00
SWQSYVDDHLCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFLAPTGLFLGGEKYVIQGEQGAVI
RGKKGPGGVTIKKTNQALVFGFYDEPTGGQCNLVVERLGDYLIESEL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3nulA00
SWQSYVDDHLXCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFLAPTGLFLGGEKYXVIQGEQGA
VIRGKKGPGGVTIKKTNQALVFGFYDEPXTGGQCNLVVERLGDYLIESEL
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "3nul000" to "3nulA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:29

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"