CATH Domain: 3grsA03 XML data for domain: 3grsA03

Molscript image for 3grsA03
3grsA03
PDB coordinates for domain 3grsA03

PDB 3grs, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.30 Gene3D
3.30.390.30.1
3.30.390.30.1.1
3.30.390.30.1.1.1
3.30.390.30.1.1.1.1
3.30.390.30.1.1.1.1.1

[top]
Segment boundaries for domain 3grsA03

Chopping figure for domain 3grsA03
DomainStart PDB ResidueStop PDB Residue
3grsA01 18 160
3grsA01 290 365
3grsA02 161 289
3grsA03 366 478

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 3.30.390.30.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2nvkX03 92.05 Protein homodimerization activityThioredoxin reductase 1, mitochondrialDetermination of adult lifespanThioredoxin-disulfide reductase activityGlutathione-disulfide reductase activity 3.30.390.30 115 31 98 1.33 1.35
1fecA03 90.80 Trypanothione reductaseCrithidia fasciculata 3.30.390.30 126 38 88 1.07 1.21
1ebdA03 88.49 Dihydrolipoyl dehydrogenaseGeobacillus stearothermophilus 3.30.390.30 115 25 96 2.60 2.69
2eq6A03 87.39 Dihydrolipoyl dehydrogenaseCitrate cycle (TCA cycle)Pyruvate metabolismValine, leucine and isoleucine degradationGlycine, serine and threonine metabolism 3.30.390.30 123 30 90 2.63 2.91
2a8xA03 86.05 Citrate cycle (TCA cycle)Pyruvate metabolismValine, leucine and isoleucine degradationGlycine, serine and threonine metabolismMetabolic pathways 3.30.390.30 119 25 92 2.65 2.87
1xdiA03 85.50 Citrate cycle (TCA cycle)Valine, leucine and isoleucine degradationPyruvate metabolismGlycine, serine and threonine metabolismMetabolic pathways 3.30.390.30 122 19 89 2.68 3.00
1nhpA03 83.13 NADH peroxidaseNADH peroxidase [EC:1.11.1.1]Enterococcus faecalis 3.30.390.30 113 11 89 2.98 3.33
1mo9A03 82.83 2-oxopropyl-CoM reductase, carboxylatingXanthobacter autotrophicus Py2 3.30.390.30 153 21 71 2.15 2.99
2gqwA03 79.49 Ferredoxin reductasePseudomonas sp. KKS102 3.30.390.30 89 8 66 3.09 4.66
1m6iA03 78.60 DNA damage response, signal transduction resulting in induction of apoptosisNucleusApoptosis-inducing factor 1, mitochondrialHomo sapiensDNA fragmentation involved in apoptotic nuclear change 3.30.390.30 108 9 71 3.31 4.62
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3grsA03
NIPTVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQ
GFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3grsA03
NIPTVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQ
GFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "3grs003" to "3grsA03" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:57

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"