CATH Domain: 3g8dB03 XML data for domain: 3g8dB03

Molscript image for 3g8dB03
3g8dB03
PDB coordinates for domain 3g8dB03

PDB 3g8d, Chain B, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1490 Dna Ligase; domain 1
3.30.1490.20 ATP-grasp fold, A domain Gene3D
3.30.1490.20.5
3.30.1490.20.5.1
3.30.1490.20.5.1.1
3.30.1490.20.5.1.1.1
3.30.1490.20.5.1.1.1.1

[top]
Segment boundaries for domain 3g8dB03

Chopping figure for domain 3g8dB03
DomainStart PDB ResidueStop PDB Residue
3g8dB01 1 85
3g8dB02 86 130
3g8dB02 204 444
3g8dB03 131 203

Structural Neighbourhood (15 entries)

There are 15 matching structural neighberhood comparisons for CATH ID 3.30.1490.20.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 15 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1w96A03 89.12 Endoplasmic reticulum membraneAcetyl-CoA carboxylaseProtein import into nucleusBiotin carboxylase [EC:6.3.4.14]Nuclear envelope organization 3.30.1490.20 63 31 84 1.83 2.15
1bxrA07 87.48 3.30.1490.20 70 21 90 2.19 2.42
1ehiA03 85.48 D-Alanine metabolismD-Ala-D-Ala ligase2Peptidoglycan biosynthesisD-alanine-D-alanine ligase [EC:6.3.2.4]Leuconostoc mesenteroides 3.30.1490.20 68 17 91 2.70 2.94
1gsaA03 85.12 Glutathione metabolismMetabolic pathwaysGlutathione synthase [EC:6.3.2.3]Protein bindingCytosol 3.30.1490.20 65 15 86 3.29 3.81
1i7nA01 81.99 Rattus norvegicusRegulation of neurotransmitter secretionSynapsin-2Cytoskeletal protein binding 3.30.1490.20 60 16 82 2.80 3.41
3ethA03 81.69 Purine metabolismMetabolic pathways5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]Phosphoribosylaminoimidazole carboxylase ATPase subunitEscherichia coli K-12 3.30.1490.20 62 24 82 2.41 2.93
2nu8B02 81.60 Citrate cycle (TCA cycle)Propanoate metabolismMetabolic pathwaysC5-Branched dibasic acid metabolismTricarboxylic acid cycle 3.30.1490.20 84 17 82 2.60 3.17
1vkzA02 80.92 Thermotoga maritimaPhosphoribosylamine--glycine ligase [EC:6.3.4.13]Purine metabolismPhosphoribosylamine--glycine ligaseMetabolic pathways 3.30.1490.20 70 14 90 2.90 3.21
2r6fA03 78.74 Nucleotide excision repairGeobacillus kaustophilusExcinuclease ABC subunit AExcinuclease ABC subunit A 3.30.1490.20 70 14 72 2.83 3.90
1ta8A02 77.27 DNA ligase (NAD+) [EC:6.5.1.2]DNA replicationNucleotide excision repairBase excision repairDNA ligase 3.30.1490.70 99 6 68 2.74 3.99
1x9nA02 77.08 Nucleotide excision repairDNA replicationDNA ligase 1Base excision repairDNA binding 3.30.1490.70 83 2 67 2.29 3.39
1v9pA02 76.30 DNA ligaseThermus filiformis 3.30.1490.70 98 10 70 2.80 3.98
1fviA01 75.72 Paramecium bursaria Chlorella virus 1A544R protein 3.30.1490.70 79 9 69 3.36 4.83
2c60A01 75.64 Neurotrophin signaling pathwayMitogen-activated protein kinase kinase kinase 3MAPKKK cascadeProtein bindingPositive regulation of I-kappaB kinase/NF-kappaB cascade 3.10.20.240 77 1 81 3.60 4.40
3l4jA02 74.99 Reciprocal meiotic recombinationDNA topoisomerase 2Regulation of mitotic recombinationDNA topoisomerase II [EC:5.99.1.3]DNA strand elongation involved in DNA replication 3.30.1490.30 47 2 54 2.58 4.71
[1]
Displaying entries 1 to 15 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3g8dB03
VPGSDGPLGDDMDKNRAIAKRIGYPVIIKASGGGGGRGMRVVRGDAELAQSISMTRAEAKAAFSNDMVYMEKY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3g8dB03
VPGSDGPLGDDMDKNRAIAKRIGYPVIIKASGGGGGRGMRVVRGDAELAQSISMTRAEAKAAFSNDMVYMEKY
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 10 Mar 2009 14:27

Assigning to "3.30.1490.20" based on similarity with "1bncA03"

Flow stage update by auto on 10 Mar 2009 14:26

No in_process hits for Domain "3g8dB03" ready to be processed

Update comment by auto on 10 Mar 2009 11:31

Domain "3g8dB03" hits Domain "3g8cA03" (100% over 100%) which is currently in process

Flow stage update by auto on 10 Mar 2009 11:10

Domain "3g8dB03" hits Domain "3g8cA03" (100% over 100%) which is currently in process

Flow stage update by auto on 10 Mar 2009 11:10

All required files are present for Domain "3g8dB03"

Flow stage update by auto on 10 Mar 2009 11:10

NW result present for Domain "3g8dB03"

Flow stage update by auto on 09 Mar 2009 09:56

Beginning processing for Domain "3g8dB03"

Insertion by auto on 09 Mar 2009 09:19

Final ChopClose added based on similarity with "3g8cA"