CATH Domain: 3fvbA00 XML data for domain: 3fvbA00

Molscript image for 3fvbA00
3fvbA00
PDB coordinates for domain 3fvbA00

PDB 3fvb, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1260 Ferritin;
1.20.1260.10 Gene3D
1.20.1260.10.8
1.20.1260.10.8.1
1.20.1260.10.8.1.1
1.20.1260.10.8.1.1.1
1.20.1260.10.8.1.1.1.1

[top]
Segment boundaries for domain 3fvbA00

Chopping figure for domain 3fvbA00
DomainStart PDB ResidueStop PDB Residue
3fvbA00 -1 159

Structural Neighbourhood (13 entries)

There are 13 matching structural neighberhood comparisons for CATH ID 1.20.1260.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 13 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1nfvA00 91.87 BacterioferritinBacterioferritinDesulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774 1.20.1260.10 169 29 94 2.45 2.59
1vlgA00 90.02 Porphyrin and chlorophyll metabolismThermotoga maritimaFerritin [EC:1.16.3.1]Ferritin 1.20.1260.10 164 21 97 2.87 2.94
2qqyA00 89.87 Bacillus anthracisBacterioferritinPutative uncharacterized protein 1.20.1260.10 133 25 82 2.32 2.81
1lkoA01 89.59 Desulfovibrio vulgaris str. HildenboroughIron ion bindingRubrerythrin 1.20.1260.10 145 17 88 2.62 2.95
2fjcB00 88.62 Treponema pallidumStarvation-inducible DNA-binding proteinAntigen TpF1 1.20.1260.10 156 8 88 2.77 3.14
2ib0A01 87.94 Mycobacterium tuberculosisCONSERVED HYPOTHETICAL ALANINE RICH PROTEIN 1.20.1260.10 135 10 82 2.36 2.86
1tjoB00 87.93 DNA protection during starvation proteinHalobacterium salinarum 1.20.1260.10 175 16 86 3.24 3.75
2yw6B00 87.84 Mycobacterium smegmatisDNA protection during starvation proteinStarvation-inducible DNA-binding protein 1.20.1260.10 150 15 87 2.40 2.74
3a9qE00 87.76 Ferritin-4, chloroplasticGlycine max 1.20.1260.10 168 16 91 2.88 3.16
3kwoA00 87.01 DNA protection during starvation proteinCampylobacter jejuniStarvation-inducible DNA-binding proteinProtein binding 1.20.1260.10 144 13 84 2.90 3.43
2oh3A01 84.72 Magnetospirillum magneticum AMB-1Uncharacterized conserved protein 1.20.1260.10 132 18 77 2.70 3.51
1jkvA01 84.45 Lactobacillus plantarumManganese catalase 1.20.1260.10 197 16 72 2.47 3.40
2rklB00 70.41 Multivesicular bodyVacuolar protein sorting-associated protein VTA1Membrane fractionProtein bindingEndocytosis 1.20.5.420 50 8 31 1.12 3.61
[1]
Displaying entries 1 to 13 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3fvbA00
GSMKGEPKVIERLNEALFLELGAVNQYWLHYRLLNDWGYTRLAKKEREESIEEMHHADKLIDRIIFLEGFPNLQTVSPLR
IGQNVKEVLEADLKGEYDARASYKESREICDKLGDYVSKQLFDELLADEEGHIDFLETQLDLLAKIGGERYGQLNAAPAD
E
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3fvbA00
GSMKGEPKVIERLNEALFLELGAVNQYWLHYRLLNDWGYTRLAKKEREESIEEMHHADKLIDRIIFLEGFPNLQTVSPLR
IGQNVKEVLEADLKGEYDARASYKESREICDKLGDYVSKQLFDELLADEEGHIDFLETQLDLLAKIGGERYGQLNAAPAD
EAE
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 03 Mar 2009 21:27

Assigning to "1.20.1260.10" based on similarity with "1jgcA00"

Flow stage update by auto on 03 Mar 2009 20:58

No in_process hits for Domain "3fvbA00" ready to be processed

Flow stage update by auto on 03 Mar 2009 20:57

NW result present for Domain "3fvbA00"

Flow stage update by auto on 19 Feb 2009 11:52

All required files are present for Domain "3fvbA00"

Flow stage update by auto on 18 Feb 2009 18:12

Beginning processing for Domain "3fvbA00"

Insertion by auto on 18 Feb 2009 16:59

Final ChopClose added based on similarity with "1jgcA"