CATH Domain: 3fi8A02 XML data for domain: 3fi8A02

Molscript image for 3fi8A02
3fi8A02
PDB coordinates for domain 3fi8A02

PDB 3fi8, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.1200 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2
3.90.1200.10 Gene3D
3.90.1200.10.5
3.90.1200.10.5.1
3.90.1200.10.5.1.1
3.90.1200.10.5.1.1.1
3.90.1200.10.5.1.1.1.1

[top]
Segment boundaries for domain 3fi8A02

Chopping figure for domain 3fi8A02
DomainStart PDB ResidueStop PDB Residue
3fi8A01 79 144
3fi8A01 172 185
3fi8A02 154 171
3fi8A02 186 432

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.90.1200.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2qg7D02 86.83 Ethanolamine kinase [EC:2.7.1.82]Glycerophospholipid metabolismPlasmodium vivaxEthanolamine kinase, putativeMetabolic pathways 3.90.1200.10 261 23 88 2.67 3.00
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3fi8A02
PLSEFEVYKTMSKYRIAPLYGDPLSIDDLKNKSILVGIANVLGKFHTLSRKRHLPEHWDKTPCVFKMMDRWRLAVSNYKN
LDKVTLDINKYIQESHKFLKFIKIYTQIENIANDIVFCHNDLQENNIMNTNKCLRLIDFEYSGYNFLSADIANFFIETTI
DYSYNAYPFFIINKKNYISYESRILFVTTYLSKYLDDSTAADQDIIDQFLEAIEVQALGLHLIWAFWSIIRGYQTFDFFL
YAKERLKMYDEQKQYLMSK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3fi8A02
PLSEFEVYKTMSKYRIAPLYGDPLSIDDLKNKSILVGIANVLGKFHTLSRKRHLPEHWDKTPCVFKMMDRWRLAVSNYKN
LDKVTLDINKYIQESHKFLKFIKIYTQIENIANDIVFCHNDLQENNIMNTNKCLRLIDFEYSGYNFLSADIANFFIETTI
DYSYNAYPFFIINKKNYISYESRILFVTTYLSKYLDDSTAASDQDIIDQFLEAIEVQALGLHLIWAFWSIIRGYQTKSYN
EFDFFLYAKERLKMYDEQKQYLMSKNIIKDYDD
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 27 Mar 2009 11:16

Assigning to "3.90.1200.10" based on similarity with "3c5iA02"

Flow stage update by auto on 27 Mar 2009 11:16

No in_process hits for Domain "3fi8A02" ready to be processed

Update comment by auto on 27 Mar 2009 11:14

Domain "3fi8A02" hits Domain "3c5iB02" (73.2600732600733% over 96.797153024911%) which is currently in process

Update comment by auto on 27 Mar 2009 11:11

Domain "3fi8A02" hits Domain "3c5iA02" (73.2600732600733% over 96.797153024911%) which is currently in process

Update comment by auto on 27 Mar 2009 11:09

Domain "3fi8A02" hits Domain "3c5iD02" (73.2600732600733% over 96.797153024911%) which is currently in process

Update comment by auto on 03 Mar 2009 21:13

Domain "3fi8A02" hits Domain "3c5iC02" (73.2600732600733% over 96.797153024911%) which is currently in process

Flow stage update by auto on 03 Mar 2009 20:58

Domain "3fi8A02" hits Domain "3c5iC02" (73.2600732600733% over 96.797153024911%) which is currently in process

Flow stage update by auto on 03 Mar 2009 20:57

NW result present for Domain "3fi8A02"

Flow stage update by auto on 19 Feb 2009 11:52

All required files are present for Domain "3fi8A02"

Flow stage update by auto on 18 Feb 2009 18:12

Beginning processing for Domain "3fi8A02"

Insertion by auto on 18 Feb 2009 16:52

Final ChopClose added based on similarity with "3c5iA"