CATH Domain: 3fe3A03 XML data for domain: 3fe3A03

Molscript image for 3fe3A03
3fe3A03
PDB coordinates for domain 3fe3A03

PDB 3fe3, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.8 Helicase, Ruva Protein; domain 3
1.10.8.10 DNA helicase RuvA subunit, C-terminal domain Gene3D
1.10.8.10.8
1.10.8.10.8.1
1.10.8.10.8.1.1
1.10.8.10.8.1.1.1
1.10.8.10.8.1.1.1.1

[top]
Segment boundaries for domain 3fe3A03

Chopping figure for domain 3fe3A03
DomainStart PDB ResidueStop PDB Residue
3fe3A01 50 134
3fe3A02 135 324
3fe3A03 325 366

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 1.10.8.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1jftA01 76.99 LacI family transcriptional regulator, purine nucleotide synthesis repressorHTH-type transcriptional repressor purREscherichia coli K-12 1.10.260.40 57 11 63 3.00 4.75
1uxdA00 75.68 LacI family transcriptional regulator, fructose operon transcriptional repressorFructose repressorEscherichia coli K-12 1.10.260.40 59 7 62 2.90 4.62
1rzsA00 73.71 Enterobacteria phage P22Regulatory protein cro 1.10.260.40 61 7 67 3.08 4.58
1neqA00 71.91 DNA-binding protein NerEnterobacteria phage Mu 1.10.260.40 74 4 55 2.55 4.60
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3fe3A03
DISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITATYLLLGR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3fe3A03
DISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITATYLLLGRK
BLAST against CATH

[top]
Domain History Events (28)

Domain assigned by auto on 16 Mar 2009 16:54

Assigning to "1.10.8.10" based on similarity with "3fe3B03"

Flow stage update by auto on 16 Mar 2009 16:53

No in_process hits for Domain "3fe3A03" ready to be processed

Update comment by auto on 16 Mar 2009 16:51

Domain "3fe3A03" hits Domain "3fe3B03" (100% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:48

Domain "3fe3A03" hits Domain "2r0iA03" (55.8139534883721% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:46

Domain "3fe3A03" hits Domain "2r0iB03" (55.8139534883721% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:43

Domain "3fe3A03" hits Domain "2qnjB03" (100% over 93.4782608695652%) which is currently in process

Update comment by auto on 16 Mar 2009 16:40

Domain "3fe3A03" hits Domain "2qnjA03" (100% over 93.4782608695652%) which is currently in process

Update comment by auto on 16 Mar 2009 16:38

Domain "3fe3A03" hits Domain "1zmwB03" (55.8139534883721% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:35

Domain "3fe3A03" hits Domain "1zmwA03" (55.8139534883721% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:32

Domain "3fe3A03" hits Domain "1zmuA03" (55.8139534883721% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:30

Domain "3fe3A03" hits Domain "1zmuB03" (55.8139534883721% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:27

Domain "3fe3A03" hits Domain "1zmvA03" (55.8139534883721% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:24

Domain "3fe3A03" hits Domain "1zmvB03" (55.8139534883721% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:22

Domain "3fe3A03" hits Domain "1y8gA03" (51.1627906976744% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:19

Domain "3fe3A03" hits Domain "2hakD03" (60.4651162790698% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:17

Domain "3fe3A03" hits Domain "2hakF03" (60.4651162790698% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:14

Domain "3fe3A03" hits Domain "2hakH03" (60.4651162790698% over 89.5833333333333%) which is currently in process

Update comment by auto on 16 Mar 2009 16:11

Domain "3fe3A03" hits Domain "2hakA03" (60.4651162790698% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:09

Domain "3fe3A03" hits Domain "2hakE03" (60.4651162790698% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:06

Domain "3fe3A03" hits Domain "2hakC03" (60.4651162790698% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:04

Domain "3fe3A03" hits Domain "2hakB03" (60.4651162790698% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:02

Domain "3fe3A03" hits Domain "1y8gB03" (51.1627906976744% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 11:41

Domain "3fe3A03" hits Domain "2hakG03" (60.4651162790698% over 100%) which is currently in process

Flow stage update by auto on 16 Mar 2009 11:21

Domain "3fe3A03" hits Domain "2hakG03" (60.4651162790698% over 100%) which is currently in process

Flow stage update by auto on 16 Mar 2009 11:21

NW result present for Domain "3fe3A03"

Flow stage update by auto on 15 Mar 2009 11:17

All required files are present for Domain "3fe3A03"

Flow stage update by auto on 15 Mar 2009 07:28

Beginning processing for Domain "3fe3A03"

Insertion by auto on 14 Mar 2009 22:50

Final ChopClose added based on similarity with "2qnjA"