CATH Domain: 3f70B02 XML data for domain: 3f70B02

Molscript image for 3f70B02
3f70B02
PDB coordinates for domain 3f70B02

PDB 3f70, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.30 SH3 type barrels.
2.30.30.160 Gene3D
2.30.30.160.6
2.30.30.160.6.1
2.30.30.160.6.1.1
2.30.30.160.6.1.1.1
2.30.30.160.6.1.1.1.1

[top]
Segment boundaries for domain 3f70B02

Chopping figure for domain 3f70B02
DomainStart PDB ResidueStop PDB Residue
3f70B01 172 318
3f70B02 319 422
3f70B03 423 531
3f70B04 532 609

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 2.30.30.160.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1wjrA00 80.64 Scm-like with four MBT domains protein 2Homo sapiens 2.30.30.160 127 21 69 2.91 4.20
1khcA01 80.11 Protein complex localizationRegulation of gene expression by genetic imprintingDNA (cytosine-5)-methyltransferase 3BChromosome, centromeric regionProtein binding 2.30.30.160 65 7 61 2.03 3.31
1sf9A02 77.88 Bacillus subtilisUncharacterized protein yfhH 2.30.30.340 54 5 60 2.54 4.22
1mmdA01 75.40 ActomyosinMyosin II complexActin-myosin filament slidingProtein localizationActin filament binding 2.30.30.360 48 6 53 2.06 3.86
1irxA02 70.81 Aminoacyl-tRNA biosynthesisLysyl-tRNA synthetase, class I [EC:6.1.1.6]Pyrococcus horikoshiiLysyl-tRNA synthetase 2.30.30.300 43 13 47 2.25 4.71
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3f70B02
MKYPFRQGMRLEVVDKSQVSRTRMAVVDTVIGGRLRLLYEDGDSDDDFWCHMWSPLIHPVGWSRRVGHGIKMSCDAVPYL
FKKVRAVY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3f70B02
MKYPFRQGMRLEVVDKSQVSRTRMAVVDTVIGGRLRLLYEDGDSDDDFWCHMWSPLIHPVGWSRRVGHGIKMSERRSDMA
HHPTFRKIYCDAVPYLFKKVRAVY
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 31 Mar 2009 12:06

Assigning to "2.30.30.160" based on similarity with "3ceyA02"

Flow stage update by auto on 31 Mar 2009 12:06

No in_process hits for Domain "3f70B02" ready to be processed

Update comment by auto on 31 Mar 2009 12:04

Domain "3f70B02" hits Domain "3dbbB02" (100% over 100%) which is currently in process

Update comment by auto on 31 Mar 2009 12:02

Domain "3f70B02" hits Domain "3ceyA02" (100% over 100%) which is currently in process

Update comment by auto on 31 Mar 2009 12:00

Domain "3f70B02" hits Domain "3dbbA02" (100% over 100%) which is currently in process

Update comment by auto on 11 Jan 2009 20:43

Domain "3f70B02" hits Domain "3ceyB02" (100% over 100%) which is currently in process

Flow stage update by auto on 11 Jan 2009 20:32

Domain "3f70B02" hits Domain "3ceyB02" (100% over 100%) which is currently in process

Flow stage update by auto on 11 Jan 2009 20:10

NW result present for Domain "3f70B02"

Flow stage update by auto on 10 Jan 2009 14:28

All required files are present for Domain "3f70B02"

Flow stage update by auto on 09 Jan 2009 14:43

Beginning processing for Domain "3f70B02"

Insertion by auto on 09 Jan 2009 14:05

Final ChopClose added based on similarity with "3dbbA"