CATH Domain: 3f66B01 XML data for domain: 3f66B01

Molscript image for 3f66B01
3f66B01
PDB coordinates for domain 3f66B01

PDB 3f66, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.200 Phosphorylase Kinase; domain 1
3.30.200.20 Phosphorylase Kinase; domain 1 Gene3D
3.30.200.20.7
3.30.200.20.7.1
3.30.200.20.7.1.1
3.30.200.20.7.1.1.1
3.30.200.20.7.1.1.1.1

[top]
Segment boundaries for domain 3f66B01

Chopping figure for domain 3f66B01
DomainStart PDB ResidueStop PDB Residue
3f66B01 1062 1159
3f66B02 1160 1349

Structural Neighbourhood (55 entries)

There are 55 matching structural neighberhood comparisons for CATH ID 3.30.200.20.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 55 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1xbbA01 89.65 T cell receptor complexTyrosine-protein kinase SYKOrgan morphogenesisLeukocyte cell-cell adhesionCell proliferation 3.30.200.20 83 25 90 1.77 1.95
2rgpA01 88.58 Calcium signaling pathwayPositive regulation of nitric oxide biosynthetic processEpidermal growth factor receptor activityResponse to UV-APositive regulation of cyclin-dependent protein kinase activity involved in G1/S 3.30.200.20 82 29 91 1.71 1.86
1fmkA03 88.40 Epithelial cell signaling in Helicobacter pylori infectionPositive regulation of integrin activationRegulation of bone resorptionProto-oncogene tyrosine-protein kinase SrcErbB signaling pathway 3.30.200.20 86 25 89 1.72 1.92
3eqrB01 87.86 Activated CDC42 kinase 1GTPase inhibitor activitySmall GTPase mediated signal transductionHomo sapiensPositive regulation of peptidyl-tyrosine phosphorylation 3.30.200.20 91 28 85 2.35 2.74
3c4cA01 87.79 Neurotrophin signaling pathwayNon-small cell lung cancerCytoplasmErbB signaling pathwayProtein phosphorylation 3.30.200.20 86 25 88 1.65 1.87
3f3zA01 87.61 Cryptosporidium parvum Iowa IICalcium-dependent protein kinase [EC:2.7.11.1]Calcium/calmodulin-dependent protein kinase with a kinase domain and 4 calmodulin like EF hands 3.30.200.20 81 24 87 2.09 2.40
3bu3A01 87.26 Insulin receptorInsulin receptor complexPositive regulation of nitric oxide biosynthetic processPhosphoinositide 3-kinase bindingPositive regulation of respiratory burst 3.30.200.20 92 29 84 2.23 2.63
2wtkC01 86.75 NucleusSerine/threonine-protein kinase 11Cell cycle arrestProtein bindingSerine/threonine-protein kinase 11 [EC:2.7.11.9] 3.30.200.20 89 17 79 1.82 2.28
1tkiA01 86.71 Structural constituent of muscleCalcium ion bindingSarcomere organizationTelethonin bindingActin filament binding 3.30.200.20 84 17 88 2.61 2.96
3cc6A01 86.56 Calcium signaling pathwayChemokine signaling pathwayPositive regulation of cell proliferationProtein-tyrosine kinase 2-betaLeukocyte transendothelial migration 3.30.200.20 90 28 87 3.38 3.85
1qpcA01 86.49 Pericentriolar materialPhosphoinositide 3-kinase bindingCD8 receptor bindingT cell receptor signaling pathwayCD4 receptor binding 3.30.200.20 88 24 93 2.27 2.44
2clqA01 86.43 Induction of apoptosis by extracellular signalsProtein homodimerization activityMitogen-activated protein kinase kinase kinase 5 [EC:2.7.11.25]Neurotrophin signaling pathwayATP binding 3.30.200.20 85 18 87 2.18 2.50
3comB01 86.37 Transcription factor bindingPathways in cancerNon-small cell lung cancerCytoplasmSerine/threonine-protein kinase 4 3.30.200.20 85 18 90 3.72 4.11
2evaA01 86.32 Positive regulation of T cell cytokine productionActivation of NF-kappaB-inducing kinase activityPositive regulation of interleukin-2 productionMitogen-activated protein kinase kinase kinase 7Protein binding 3.30.200.20 82 28 90 2.58 2.85
2zv2A01 86.10 Calcium ion bindingRegulation of protein kinase activityPositive regulation of transcriptionMAPKKK cascadeCytoplasm 3.30.200.20 77 22 84 3.21 3.79
2r3iA01 85.95 Progesterone-mediated oocyte maturationPathways in cancerSmall cell lung cancerOocyte meiosisProstate cancer 3.30.200.20 76 23 83 1.96 2.35
1lufA01 85.90 Muscle, skeletal receptor tyrosine protein kinaseReceptor clusteringRattus norvegicusResponse to muscle activityMemory 3.30.200.20 97 25 85 2.23 2.61
3blhA01 85.78 Transcription elongation from RNA polymerase II promoterCyclin-dependent protein kinase activityRNA polymerase II carboxy-terminal domain kinase activityProtein bindingCell proliferation 3.30.200.20 86 23 93 3.83 4.12
3bceA01 85.66 Receptor tyrosine-protein kinase erbB-4Transmembrane receptor protein tyrosine kinase activityHomo sapiensBasolateral plasma membraneProtein binding 3.30.200.20 94 32 88 3.62 4.10
2vgpB01 85.47 Serine/threonine-protein kinase 12-AHistone H3-S10 phosphorylationChromosome, centromeric regionProtein bindingChromatin 3.30.200.20 89 21 83 2.33 2.80
2rkuA01 85.43 Polo-like kinase 1 [EC:2.7.11.21]Polo kinase kinase activityProgesterone-mediated oocyte maturationCell proliferationOocyte meiosis 3.30.200.20 89 16 83 2.10 2.53
2h6dA01 85.38 Insulin signaling pathwayHypertrophic cardiomyopathy (HCM)Adipocytokine signaling pathwayRegulation of autophagyMTOR signaling pathway 3.30.200.20 86 24 87 3.69 4.23
2ac3A01 85.32 MAP kinase-interacting serine/threonine-protein kinase 2ATP bindingProtein phosphorylationHomo sapiensProtein serine/threonine kinase activity 3.30.200.20 80 20 83 1.83 2.19
3fhrA01 85.13 Response to stressMAP kinase kinase activityNucleusMitogen-activated protein kinase-activated protein kinase 3 [EC:2.7.11.1]MAPK signaling pathway 3.30.200.20 80 16 87 2.75 3.16
1s9jA01 85.12 Prion diseasesNeurotrophin signaling pathwayNon-small cell lung cancerT cell receptor signaling pathwayErbB signaling pathway 3.30.200.20 86 11 88 2.21 2.50
3c0iA01 85.09 Actin cytoskeletonGuanylate kinase activityPeripheral plasma membrane protein CASKCell adhesionHomo sapiens 3.30.200.20 88 21 85 2.85 3.34
2acxA02 84.90 G protein-coupled receptor kinase 6Homo sapiensRegulation of G-protein coupled receptor protein signaling pathway 3.30.200.20 91 20 83 2.45 2.93
2jamA01 84.89 Calcium/calmodulin-dependent protein kinase type 1GHomo sapiensCalcium/calmodulin-dependent protein kinase I [EC:2.7.11.17] 3.30.200.20 75 24 84 2.40 2.83
1fvrA01 84.88 Cell surfaceMicrovillusTransmembrane receptor protein tyrosine kinase signaling pathwayProtein bindingSignal transduction 3.30.200.20 86 22 90 2.75 3.03
2j51A01 84.74 CytoplasmOocyte meiosisSTE20-like serine/threonine-protein kinasePlasma membraneHomo sapiens 3.30.200.20 90 20 86 2.41 2.78
1opjA01 84.70 Protein domain specific bindingNucleusPeptidyl-tyrosine phosphorylationManganese ion bindingMus musculus 3.30.200.20 94 28 88 3.48 3.94
3e64A01 84.62 Jak-STAT signaling pathwayCellular component movementTyrosine-protein kinase JAK2Chemokine signaling pathwayAdipocytokine signaling pathway 3.30.200.20 93 22 84 3.28 3.86
1ob3A01 84.61 Cyclin-dependent kinase [EC:2.7.11.22]Cell division control protein 2 homologPlasmodium falciparum K1 3.30.200.20 83 20 84 2.04 2.41
1ia8A01 84.29 SenescenceReciprocal meiotic recombinationSerine/threonine-protein kinase Chk1Regulation of cyclin-dependent protein kinase activityProtein binding 3.30.200.20 93 20 81 3.68 4.50
2weiA01 84.28 Cryptosporidium parvum Iowa IICalmodulin-domain protein kinase 1, putative 3.30.200.20 90 23 85 3.32 3.88
1uu3A02 84.12 PPAR signaling pathway3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]Peptidyl-threonine phosphorylationAldosterone-regulated sodium reabsorptionNon-small cell lung cancer 3.30.200.20 93 20 83 2.87 3.42
1u5qA01 83.93 Rattus norvegicusThousand and one amino acid protein kinase [EC:2.7.11.1]Serine/threonine-protein kinase TAO2MAPK signaling pathway 3.30.200.20 96 22 84 2.34 2.77
2oibA01 83.64 Chagas diseaseNeurotrophin signaling pathwayInterleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]ApoptosisHomo sapiens 3.30.200.20 93 24 83 3.03 3.61
3hmmA01 83.57 Type II transforming growth factor beta receptor bindingPeptidyl-threonine phosphorylationPositive regulation of cellular component movementPathway-restricted SMAD protein phosphorylationResponse to cholesterol 3.30.200.20 84 19 83 2.38 2.85
1zy4A01 83.17 Eukaryotic translation initiation factor 2alpha kinase activityProtein bindingSerine/threonine-protein kinase GCN2DNA damage checkpointRegulation of translational initiation 3.30.200.20 94 20 80 3.28 4.06
3k3iA01 82.74 Cellular component movementMAP kinase kinase activityProtein bindingChemotaxisMitogen-activated protein kinase 14 3.30.200.20 92 20 80 3.41 4.24
2j0iA01 82.54 Cellular component movementT cell receptor signaling pathwaySignal transductionProtein bindingRenal cell carcinoma 3.30.200.20 98 29 82 2.94 3.56
2qkwB01 82.49 Solanum pimpinellifoliumProtein kinaseProtein binding 3.30.200.20 72 29 74 2.01 2.71
1q5kA01 82.39 Hedgehog signaling pathwayNeurotrophin signaling pathwayAlzheimer's diseaseT cell receptor signaling pathwayER overload response 3.30.200.20 95 24 87 4.09 4.68
2w5aA01 81.82 NIMA (never in mitosis gene a)-related kinase [EC:2.7.11.1]Regulation of mitosisSerine/threonine-protein kinase Nek2CentrosomeCentrosome separation 3.30.200.20 64 15 68 2.76 4.04
3g51A01 81.66 Progesterone-mediated oocyte maturationNeurotrophin signaling pathwayOocyte meiosisMAPK signaling pathwayLong-term potentiation 3.30.200.20 95 20 85 4.05 4.75
1xwsA01 81.51 Transcription factor bindingPositive regulation of cyclin-dependent protein kinase activity involved in G1/SManganese ion bindingNegative regulation of apoptosisProtein binding 3.30.200.20 92 22 79 2.62 3.30
2dylA01 81.00 Mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]MAP kinase kinase activityNeurotrophin signaling pathwayStress-activated MAPK cascadeT cell receptor signaling pathway 3.30.200.20 91 9 76 3.45 4.49
2f57B01 80.18 T cell receptor signaling pathwayP21-activated kinase 7 [EC:2.7.11.1]Protein bindingRenal cell carcinomaErbB signaling pathway 3.30.200.20 106 27 75 3.12 4.13
2oo8X01 79.95 Cell surfaceMicrovillusTransmembrane receptor protein tyrosine kinase signaling pathwayProtein bindingSignal transduction 3.30.200.20 60 23 62 2.44 3.91
1omwA03 79.77 MembraneG-protein coupled receptor kinase activityNegative regulation of the force of heart contraction by chemical signalChemokine signaling pathwayMuscarinic acetylcholine receptor signaling pathway 3.30.200.20 107 21 69 2.60 3.76
1o6lA02 79.23 Jak-STAT signaling pathwayRAC-beta serine/threonine-protein kinaseNeurotrophin signaling pathwayNon-small cell lung cancerT cell receptor signaling pathway 3.30.200.20 117 20 64 2.27 3.54
1rdqE02 78.55 Calcium signaling pathwayPrion diseasesProtein kinase A [EC:2.7.11.11]Olfactory transductionMesoderm formation 3.30.200.20 124 18 63 2.28 3.58
1kutB01 76.68 Thermotoga maritimaPhosphoribosylaminoimidazole-succinocarboxamide synthasePurine metabolismPhosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]Metabolic pathways 3.30.200.20 88 7 64 3.08 4.76
2jedB01 75.93 Protein kinase C theta typeProtein bindingT cell receptor signaling pathwayNovel protein kinase C [EC:2.7.11.13]Adipocytokine signaling pathway 3.30.200.20 125 16 59 2.55 4.31
[1]
Displaying entries 1 to 55 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3f66B01
LVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLKKIHCAVKSLNEVSQFLTEGIIMKDFSHPNVLSLLGICLRSPL
VVLPY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3f66B01
HIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIM
KDFSHPNVLSLLGICLRSEGSPLVVLPY
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 11 Jan 2009 15:17

Assigning to "3.30.200.20" based on similarity with "3f66A01"

Flow stage update by auto on 11 Jan 2009 15:15

No in_process hits for Domain "3f66B01" ready to be processed

Update comment by auto on 11 Jan 2009 12:06

Domain "3f66B01" hits Domain "3f66A01" (100% over 100%) which is currently in process

Flow stage update by auto on 11 Jan 2009 11:35

Domain "3f66B01" hits Domain "3f66A01" (100% over 100%) which is currently in process

Flow stage update by auto on 11 Jan 2009 11:35

NW result present for Domain "3f66B01"

Flow stage update by auto on 08 Jan 2009 11:39

All required files are present for Domain "3f66B01"

Flow stage update by auto on 08 Jan 2009 07:07

Beginning processing for Domain "3f66B01"

Insertion by auto on 08 Jan 2009 03:17

Final ChopClose added based on similarity with "3f66A"