Domain assigned by auto on 15 Dec 2008 20:39
Assigning to "3.30.200.20" based on similarity with "1mruA01"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 3f61A01 | 1 | 94 |
| 3f61A02 | 96 | 285 |
There are 37 matching structural neighberhood comparisons for CATH ID 3.30.200.20.20.1.1.1.1 (SIMAX score < 5)
>pdb|3f61A01 MTTPSHLSDRYELGEILGFGGMSEVHLARDLRDHRDVAVKVLRADLARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEA ETPAGPLPYIVMEY
Assigning to "3.30.200.20" based on similarity with "1mruA01"
No in_process hits for Domain "3f61A01" ready to be processed
NW result present for Domain "3f61A01"
All required files are present for Domain "3f61A01"
Beginning processing for Domain "3f61A01"
Final ChopClose added based on similarity with "1mruA"