CATH Domain: 3ezqB00 XML data for domain: 3ezqB00

Molscript image for 3ezqB00
3ezqB00
PDB coordinates for domain 3ezqB00

PDB 3ezq, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.533 Death Domain, Fas
1.10.533.10 Death Domain, Fas Gene3D
1.10.533.10.5
1.10.533.10.5.1
1.10.533.10.5.1.1
1.10.533.10.5.1.1.1
1.10.533.10.5.1.1.1.1

[top]
Segment boundaries for domain 3ezqB00

Chopping figure for domain 3ezqB00
DomainStart PDB ResidueStop PDB Residue
3ezqB00 93 191

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 1.10.533.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ichA00 86.57 Integral to plasma membraneChagas diseaseTumor necrosis factor receptor superfamily member 1AAlzheimer's diseasePositive regulation of I-kappaB kinase/NF-kappaB cascade 1.10.533.10 87 24 85 2.08 2.42
1ngrA00 83.52 Negative regulation of muscle organ developmentRattus norvegicusNucleusNeurotrophin signaling pathwayTumor necrosis factor receptor superfamily member 16 1.10.533.10 85 22 81 2.37 2.90
1dgnA00 81.76 Caspase recruitment domain-containing protein 18NOD-like receptor signaling pathwayCaspase recruitment domain-containing protein 18Homo sapiens 1.10.533.10 89 11 84 2.89 3.41
1a1wA00 79.89 FAS (TNFRSF6)-associated via death domainIdentical protein bindingPathways in cancerChagas diseaseAlzheimer's disease 1.10.533.10 83 7 79 3.16 3.96
1ddfA00 79.59 Type I diabetes mellitusPathways in cancerSoluble fractionChagas diseaseAutoimmune thyroid disease 1.10.533.10 127 17 77 3.11 4.03
1ucpA00 78.85 Protein homodimerization activityApoptosis-associated speck-like protein containing a CARDPositive regulation of interleukin-1 beta secretionPyrin domain bindingTumor necrosis factor-mediated signaling pathway 1.10.533.10 91 7 78 2.78 3.53
1n3kA00 78.53 Astrocytic phosphoprotein PEA-15Cricetulus griseus 1.10.533.10 130 7 66 2.86 4.27
3crdA00 76.46 Death domain-containing protein CRADDDeath domain bindingProtease bindingProtein binding, bridgingHomo sapiens 1.10.533.10 100 9 93 4.27 4.59
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3ezqB00
GEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNL
VADLVQEVQQARDLQNRSG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3ezqB00
GEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNL
VADLVQEVQQARDLQNRSG
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 11 Jan 2009 03:30

Assigning to "1.10.533.10" based on similarity with "3ezqN00"

Flow stage update by auto on 11 Jan 2009 03:29

No in_process hits for Domain "3ezqB00" ready to be processed

Update comment by auto on 11 Jan 2009 02:13

Domain "3ezqB00" hits Domain "3ezqN00" (100% over 100%) which is currently in process

Update comment by auto on 11 Jan 2009 00:41

Domain "3ezqB00" hits Domain "3ezqP00" (100% over 100%) which is currently in process

Flow stage update by auto on 10 Jan 2009 23:36

Domain "3ezqB00" hits Domain "3ezqP00" (100% over 100%) which is currently in process

Flow stage update by auto on 10 Jan 2009 23:36

NW result present for Domain "3ezqB00"

Flow stage update by auto on 08 Jan 2009 11:39

All required files are present for Domain "3ezqB00"

Flow stage update by auto on 07 Jan 2009 21:27

Beginning processing for Domain "3ezqB00"

Insertion by auto on 07 Jan 2009 20:09

Final ChopClose added based on similarity with "3ezqF"