CATH Domain: 3exvA00 XML data for domain: 3exvA00

Molscript image for 3exvA00
3exvA00
PDB coordinates for domain 3exvA00

PDB 3exv, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.90 Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
2.60.90.10 Adenovirus Type 5 Fiber Protein (Receptor Binding Domain) Gene3D
2.60.90.10.2
2.60.90.10.2.1
2.60.90.10.2.1.1
2.60.90.10.2.1.1.1
2.60.90.10.2.1.1.1.1

[top]
Segment boundaries for domain 3exvA00

Chopping figure for domain 3exvA00
DomainStart PDB ResidueStop PDB Residue
3exvA00 129 325

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|3exvA00
DNINTLWTGVNPTEANCQIMNSSESNDCKLILTLVKTGALVTAFVYVIGVSNNFNMLTTHRNINFTAELFFDSTGNLLTR
LSSLKTPLNHKSGQNMATGAITNAKGFMPSTTAYPFNDNSREKENYIYGTCYYTASDRTAFPIDISVMLNRRAINDETSY
CIRITWSWNTGDAPEVQTSATTLVTSPFTFYYIREDD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3exvA00
DNINTLWTGVNPTEANCQIMNSSESNDCKLILTLVKTGALVTAFVYVIGVSNNFNMLTTHRNINFTAELFFDSTGNLLTR
LSSLKTPLNHKSGQNMATGAITNAKGFMPSTTAYPFNDNSREKENYIYGTCYYTASDRTAFPIDISVMLNRRAINDETSY
CIRITWSWNTGDAPEVQTSATTLVTSPFTFYYIREDD
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 02 Dec 2008 14:42

Assigning to "2.60.90.10" based on similarity with "2o39A00"

Flow stage update by auto on 02 Dec 2008 14:42

No in_process hits for Domain "3exvA00" ready to be processed

Update comment by auto on 02 Dec 2008 14:25

Domain "3exvA00" hits Domain "3exwC00" (93.4010152284264% over 92.4882629107981%) which is currently in process

Update comment by auto on 02 Dec 2008 11:24

Domain "3exvA00" hits Domain "3exwB00" (93.4010152284264% over 92.4882629107981%) which is currently in process

Flow stage update by auto on 02 Dec 2008 11:08

Domain "3exvA00" hits Domain "3exwB00" (93.4010152284264% over 92.4882629107981%) which is currently in process

Flow stage update by auto on 02 Dec 2008 11:08

NW result present for Domain "3exvA00"

Flow stage update by auto on 30 Nov 2008 08:44

All required files are present for Domain "3exvA00"

Flow stage update by auto on 29 Nov 2008 18:23

Beginning processing for Domain "3exvA00"

Insertion by auto on 29 Nov 2008 17:10

Final ChopClose added based on similarity with "2o39A"