CATH Domain: 3ethA03 XML data for domain: 3ethA03

Molscript image for 3ethA03
3ethA03
PDB coordinates for domain 3ethA03

PDB 3eth, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1490 Dna Ligase; domain 1
3.30.1490.20 ATP-grasp fold, A domain Gene3D
3.30.1490.20.6
3.30.1490.20.6.1
3.30.1490.20.6.1.1
3.30.1490.20.6.1.1.1
3.30.1490.20.6.1.1.1.1

[top]
Segment boundaries for domain 3ethA03

Chopping figure for domain 3ethA03
DomainStart PDB ResidueStop PDB Residue
3ethA01 1 70
3ethA02 71 93
3ethA02 156 355
3ethA03 94 155

Structural Neighbourhood (13 entries)

There are 13 matching structural neighberhood comparisons for CATH ID 3.30.1490.20.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 13 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ehiA03 86.26 D-Alanine metabolismD-Ala-D-Ala ligase2Peptidoglycan biosynthesisD-alanine-D-alanine ligase [EC:6.3.2.4]Leuconostoc mesenteroides 3.30.1490.20 68 14 88 2.14 2.43
1gsaA03 83.84 Glutathione metabolismMetabolic pathwaysGlutathione synthase [EC:6.3.2.3]Protein bindingCytosol 3.30.1490.20 65 11 89 2.20 2.47
1w96A03 83.02 Endoplasmic reticulum membraneAcetyl-CoA carboxylaseProtein import into nucleusBiotin carboxylase [EC:6.3.4.14]Nuclear envelope organization 3.30.1490.20 63 11 88 2.67 3.00
1bxrA07 82.88 3.30.1490.20 70 6 87 2.12 2.43
1vkzA02 82.77 Thermotoga maritimaPhosphoribosylamine--glycine ligase [EC:6.3.4.13]Purine metabolismPhosphoribosylamine--glycine ligaseMetabolic pathways 3.30.1490.20 70 11 84 2.54 3.01
1i7nA01 82.65 Rattus norvegicusRegulation of neurotransmitter secretionSynapsin-2Cytoskeletal protein binding 3.30.1490.20 60 10 85 2.37 2.77
1m0wB05 80.63 Glutathione synthase [EC:6.3.2.3]Glutathione bindingProtein homodimerization activityGlutathione metabolismMetabolic pathways 3.30.1490.50 60 8 87 4.15 4.76
2r85A03 79.82 Pyrococcus furiosus5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase [EC:6.3.4.-]Purine metabolism5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetaseMetabolic pathways 3.30.1490.20 58 8 75 2.63 3.47
3kalA05 78.97 Homoglutathione synthetaseGlycine max 3.30.1490.50 61 13 90 4.24 4.69
2nu8B02 78.64 Citrate cycle (TCA cycle)Propanoate metabolismMetabolic pathwaysC5-Branched dibasic acid metabolismTricarboxylic acid cycle 3.30.1490.20 84 11 71 2.55 3.57
1ckmA03 75.84 Paramecium bursaria Chlorella virus 1MRNA-capping enzyme 4.10.87.10 54 11 74 3.28 4.42
2r6fA03 73.51 Nucleotide excision repairGeobacillus kaustophilusExcinuclease ABC subunit AExcinuclease ABC subunit A 3.30.1490.20 70 4 72 3.19 4.38
1vajA02 72.87 Hypothetical proteinPyrococcus horikoshiiProtein PH0010 3.30.1490.150 74 11 72 3.60 4.93
[1]
Displaying entries 1 to 13 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3ethA03
TAPWQLLAERSEWPAVFDRLGELAIVKRRTGGYDGRGQWRLRANETEQLPAECYGECIVEQG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3ethA03
TAPWQLLAERSEWPAVFDRLGELAIVKRRTGGYDGRGQWRLRANETEQLPAECYGECIVEQG
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 28 Oct 2008 17:23

Assigning to "3.30.1490.20" based on similarity with "1b6rA03"

Flow stage update by auto on 28 Oct 2008 17:07

No in_process hits for Domain "3ethA03" ready to be processed

Flow stage update by auto on 28 Oct 2008 17:07

NW result present for Domain "3ethA03"

Flow stage update by auto on 26 Oct 2008 08:21

All required files are present for Domain "3ethA03"

Flow stage update by auto on 26 Oct 2008 05:27

Beginning processing for Domain "3ethA03"

Insertion by auto on 26 Oct 2008 05:24

Final ChopClose added based on similarity with "1b6rA"