CATH Domain: 3ethA02 XML data for domain: 3ethA02

Molscript image for 3ethA02
3ethA02
PDB coordinates for domain 3ethA02

PDB 3eth, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.470 D-amino Acid Aminotransferase; Chain A, domain 1
3.30.470.20 ATP-grasp fold, B domain Gene3D
3.30.470.20.10
3.30.470.20.10.1
3.30.470.20.10.1.1
3.30.470.20.10.1.1.1
3.30.470.20.10.1.1.1.1

[top]
Segment boundaries for domain 3ethA02

Chopping figure for domain 3ethA02
DomainStart PDB ResidueStop PDB Residue
3ethA01 1 70
3ethA02 71 93
3ethA02 156 355
3ethA03 94 155

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.470.20.10.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2qf7B03 79.22 Pyruvate carboxylase subunit A [EC:6.4.1.1]Citrate cycle (TCA cycle)Rhizobium etli CFN 42Pyruvate carboxylase subunit B [EC:6.4.1.1]Pyruvate metabolism 3.30.470.20 248 8 78 3.50 4.45
1vkzA03 73.04 Thermotoga maritimaPhosphoribosylamine--glycine ligase [EC:6.3.4.13]Purine metabolismPhosphoribosylamine--glycine ligaseMetabolic pathways 3.30.470.20 129 10 52 2.59 4.94
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3ethA02
RDVFPIIADRLTQKQLFDKLHLPINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQARAEEMLSA
IMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSVMINLIGSDVNY
DWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3ethA02
RDVFPIIADRLTQKQLFDKLHLPINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQARAEEMLSA
IMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSVMINLIGSDVNY
DWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFG
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 28 Oct 2008 17:23

Assigning to "3.30.470.20" based on similarity with "1b6rA02"

Flow stage update by auto on 28 Oct 2008 17:07

No in_process hits for Domain "3ethA02" ready to be processed

Flow stage update by auto on 28 Oct 2008 17:07

NW result present for Domain "3ethA02"

Flow stage update by auto on 26 Oct 2008 08:21

All required files are present for Domain "3ethA02"

Flow stage update by auto on 26 Oct 2008 05:27

Beginning processing for Domain "3ethA02"

Insertion by auto on 26 Oct 2008 05:24

Final ChopClose added based on similarity with "1b6rA"